Anti HFE pAb (ATL-HPA017276 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA017276-25

Protein Description: hemochromatosis
Gene Name: HFE
Alternative Gene Name: HLA-H
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000006611: 71%, ENSRNOG00000016967: 73%
Entrez Gene ID: 3077
Uniprot ID: Q30201
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: YLERDCPAQLQQLLELGRGVLDQQVPPLVKVTHHVTSSVTTLRCRALNYYPQNITMKWLKDKQPMDAKEFEPKDVLPNGDGTYQGWITLAVPPGEEQRYTCQVEHPGLDQPLIVIWEPSPS
• Gene Sequence: YLERDCPAQLQQLLELGRGVLDQQVPPLVKVTHHVTSSVTTLRCRALNYYPQNITMKWLKDKQPMDAKEFEPKDVLPNGDGTYQGWITLAVPPGEEQRYTCQVEHPGLDQPLIVIWEPSPS
• Gene ID - Mouse: ENSMUSG00000006611
• Gene ID - Rat: ENSRNOG00000016967
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti HFE pAb (ATL-HPA017276 w/enhanced validation) – 1 Found

Lenarduzzi, Michelle; Hui, Angela B Y; Yue, Shijun; Ito, Emma; Shi, Wei; Williams, Justin; Bruce, Jeff; Sakemura-Nakatsugawa, Noriko; Xu, Wei; Schimmer, Aaron; Liu, Fei-Fei. Hemochromatosis enhances tumor progression via upregulation of intracellular iron in head and neck cancer. Plos One. 8(8):e74075.