Anti HFE pAb (ATL-HPA017276 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA017276-25
  • Immunohistochemical staining of human urinary bladder shows strong cytoplasmic positivity in urothelial cells.
  • Western blot analysis in control (vector only transfected HEK293T lysate) and HFE over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY424725).
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: hemochromatosis
Gene Name: HFE
Alternative Gene Name: HLA-H
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000006611: 71%, ENSRNOG00000016967: 73%
Entrez Gene ID: 3077
Uniprot ID: Q30201
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen YLERDCPAQLQQLLELGRGVLDQQVPPLVKVTHHVTSSVTTLRCRALNYYPQNITMKWLKDKQPMDAKEFEPKDVLPNGDGTYQGWITLAVPPGEEQRYTCQVEHPGLDQPLIVIWEPSPS
Gene Sequence YLERDCPAQLQQLLELGRGVLDQQVPPLVKVTHHVTSSVTTLRCRALNYYPQNITMKWLKDKQPMDAKEFEPKDVLPNGDGTYQGWITLAVPPGEEQRYTCQVEHPGLDQPLIVIWEPSPS
Gene ID - Mouse ENSMUSG00000006611
Gene ID - Rat ENSRNOG00000016967
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti HFE pAb (ATL-HPA017276 w/enhanced validation)
Datasheet Anti HFE pAb (ATL-HPA017276 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti HFE pAb (ATL-HPA017276 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti HFE pAb (ATL-HPA017276 w/enhanced validation)
Datasheet Anti HFE pAb (ATL-HPA017276 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti HFE pAb (ATL-HPA017276 w/enhanced validation)



Citations for Anti HFE pAb (ATL-HPA017276 w/enhanced validation) – 1 Found
Lenarduzzi, Michelle; Hui, Angela B Y; Yue, Shijun; Ito, Emma; Shi, Wei; Williams, Justin; Bruce, Jeff; Sakemura-Nakatsugawa, Noriko; Xu, Wei; Schimmer, Aaron; Liu, Fei-Fei. Hemochromatosis enhances tumor progression via upregulation of intracellular iron in head and neck cancer. Plos One. 8(8):e74075.  PubMed