Anti HFE pAb (ATL-HPA017276 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA017276-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: HFE
Alternative Gene Name: HLA-H
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000006611: 71%, ENSRNOG00000016967: 73%
Entrez Gene ID: 3077
Uniprot ID: Q30201
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | YLERDCPAQLQQLLELGRGVLDQQVPPLVKVTHHVTSSVTTLRCRALNYYPQNITMKWLKDKQPMDAKEFEPKDVLPNGDGTYQGWITLAVPPGEEQRYTCQVEHPGLDQPLIVIWEPSPS |
Gene Sequence | YLERDCPAQLQQLLELGRGVLDQQVPPLVKVTHHVTSSVTTLRCRALNYYPQNITMKWLKDKQPMDAKEFEPKDVLPNGDGTYQGWITLAVPPGEEQRYTCQVEHPGLDQPLIVIWEPSPS |
Gene ID - Mouse | ENSMUSG00000006611 |
Gene ID - Rat | ENSRNOG00000016967 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti HFE pAb (ATL-HPA017276 w/enhanced validation) | |
Datasheet | Anti HFE pAb (ATL-HPA017276 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti HFE pAb (ATL-HPA017276 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti HFE pAb (ATL-HPA017276 w/enhanced validation) | |
Datasheet | Anti HFE pAb (ATL-HPA017276 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti HFE pAb (ATL-HPA017276 w/enhanced validation) |
Citations for Anti HFE pAb (ATL-HPA017276 w/enhanced validation) – 1 Found |
Lenarduzzi, Michelle; Hui, Angela B Y; Yue, Shijun; Ito, Emma; Shi, Wei; Williams, Justin; Bruce, Jeff; Sakemura-Nakatsugawa, Noriko; Xu, Wei; Schimmer, Aaron; Liu, Fei-Fei. Hemochromatosis enhances tumor progression via upregulation of intracellular iron in head and neck cancer. Plos One. 8(8):e74075. PubMed |