Anti HEY2 pAb (ATL-HPA074851)
Atlas Antibodies
- Catalog No.:
- ATL-HPA074851-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: HEY2
Alternative Gene Name: bHLHb32, HERP1, HESR2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000019789: 88%, ENSRNOG00000013364: 90%
Entrez Gene ID: 23493
Uniprot ID: Q9UBP5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC, ChIP-Exo-Seq |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | PCEETTSESDMDETIDVGSENNYSGQSTSSVIRLNSPTTTSQIMARKK |
Gene Sequence | PCEETTSESDMDETIDVGSENNYSGQSTSSVIRLNSPTTTSQIMARKK |
Gene ID - Mouse | ENSMUSG00000019789 |
Gene ID - Rat | ENSRNOG00000013364 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti HEY2 pAb (ATL-HPA074851) | |
Datasheet | Anti HEY2 pAb (ATL-HPA074851) Datasheet (External Link) |
Vendor Page | Anti HEY2 pAb (ATL-HPA074851) at Atlas Antibodies |
Documents & Links for Anti HEY2 pAb (ATL-HPA074851) | |
Datasheet | Anti HEY2 pAb (ATL-HPA074851) Datasheet (External Link) |
Vendor Page | Anti HEY2 pAb (ATL-HPA074851) |