Anti HEY2 pAb (ATL-HPA074851)

Atlas Antibodies

Catalog No.: ATL-HPA074851-25

Protein Description: hes-related family bHLH transcription factor with YRPW motif 2
Gene Name: HEY2
Alternative Gene Name: bHLHb32, HERP1, HESR2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000019789: 88%, ENSRNOG00000013364: 90%
Entrez Gene ID: 23493
Uniprot ID: Q9UBP5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, ChIP-Exo-Seq
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PCEETTSESDMDETIDVGSENNYSGQSTSSVIRLNSPTTTSQIMARKK
• Gene Sequence: PCEETTSESDMDETIDVGSENNYSGQSTSSVIRLNSPTTTSQIMARKK
• Gene ID - Mouse: ENSMUSG00000019789
• Gene ID - Rat: ENSRNOG00000013364
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.