Anti HEY2 pAb (ATL-HPA074851)

Atlas Antibodies

Catalog No.:
ATL-HPA074851-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: hes-related family bHLH transcription factor with YRPW motif 2
Gene Name: HEY2
Alternative Gene Name: bHLHb32, HERP1, HESR2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000019789: 88%, ENSRNOG00000013364: 90%
Entrez Gene ID: 23493
Uniprot ID: Q9UBP5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, ChIP-Exo-Seq
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PCEETTSESDMDETIDVGSENNYSGQSTSSVIRLNSPTTTSQIMARKK
Gene Sequence PCEETTSESDMDETIDVGSENNYSGQSTSSVIRLNSPTTTSQIMARKK
Gene ID - Mouse ENSMUSG00000019789
Gene ID - Rat ENSRNOG00000013364
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti HEY2 pAb (ATL-HPA074851)
Datasheet Anti HEY2 pAb (ATL-HPA074851) Datasheet (External Link)
Vendor Page Anti HEY2 pAb (ATL-HPA074851) at Atlas Antibodies

Documents & Links for Anti HEY2 pAb (ATL-HPA074851)
Datasheet Anti HEY2 pAb (ATL-HPA074851) Datasheet (External Link)
Vendor Page Anti HEY2 pAb (ATL-HPA074851)