Anti HEY1 pAb (ATL-HPA055599 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA055599-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: HEY1
Alternative Gene Name: BHLHb31, CHF-2, CHF2, HERP2, HESR-1, HESR1, HRT-1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040289: 93%, ENSRNOG00000011593: 95%
Entrez Gene ID: 23462
Uniprot ID: Q9Y5J3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | HLNNYASQREAASGAHAGLGHIPWGTVFGHHPHIAHPLLLPQNGHGNAGTTASPTEPHHQG |
Gene Sequence | HLNNYASQREAASGAHAGLGHIPWGTVFGHHPHIAHPLLLPQNGHGNAGTTASPTEPHHQG |
Gene ID - Mouse | ENSMUSG00000040289 |
Gene ID - Rat | ENSRNOG00000011593 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti HEY1 pAb (ATL-HPA055599 w/enhanced validation) | |
Datasheet | Anti HEY1 pAb (ATL-HPA055599 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti HEY1 pAb (ATL-HPA055599 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti HEY1 pAb (ATL-HPA055599 w/enhanced validation) | |
Datasheet | Anti HEY1 pAb (ATL-HPA055599 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti HEY1 pAb (ATL-HPA055599 w/enhanced validation) |