Anti HEY1 pAb (ATL-HPA055599 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA055599-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: hes-related family bHLH transcription factor with YRPW motif 1
Gene Name: HEY1
Alternative Gene Name: BHLHb31, CHF-2, CHF2, HERP2, HESR-1, HESR1, HRT-1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040289: 93%, ENSRNOG00000011593: 95%
Entrez Gene ID: 23462
Uniprot ID: Q9Y5J3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen HLNNYASQREAASGAHAGLGHIPWGTVFGHHPHIAHPLLLPQNGHGNAGTTASPTEPHHQG
Gene Sequence HLNNYASQREAASGAHAGLGHIPWGTVFGHHPHIAHPLLLPQNGHGNAGTTASPTEPHHQG
Gene ID - Mouse ENSMUSG00000040289
Gene ID - Rat ENSRNOG00000011593
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti HEY1 pAb (ATL-HPA055599 w/enhanced validation)
Datasheet Anti HEY1 pAb (ATL-HPA055599 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti HEY1 pAb (ATL-HPA055599 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti HEY1 pAb (ATL-HPA055599 w/enhanced validation)
Datasheet Anti HEY1 pAb (ATL-HPA055599 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti HEY1 pAb (ATL-HPA055599 w/enhanced validation)