Anti HEY1 pAb (ATL-HPA055599 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA055599-25

• 
• 

Protein Description: hes-related family bHLH transcription factor with YRPW motif 1
Gene Name: HEY1
Alternative Gene Name: BHLHb31, CHF-2, CHF2, HERP2, HESR-1, HESR1, HRT-1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040289: 93%, ENSRNOG00000011593: 95%
Entrez Gene ID: 23462
Uniprot ID: Q9Y5J3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: HLNNYASQREAASGAHAGLGHIPWGTVFGHHPHIAHPLLLPQNGHGNAGTTASPTEPHHQG
• Gene Sequence: HLNNYASQREAASGAHAGLGHIPWGTVFGHHPHIAHPLLLPQNGHGNAGTTASPTEPHHQG
• Gene ID - Mouse: ENSMUSG00000040289
• Gene ID - Rat: ENSRNOG00000011593
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.