Anti HEXIM2 pAb (ATL-HPA023323 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA023323-25

• 
• 

Protein Description: hexamethylene bis-acetamide inducible 2
Gene Name: HEXIM2
Alternative Gene Name: FLJ32384
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000043372: 76%, ENSRNOG00000021287: 76%
Entrez Gene ID: 124790
Uniprot ID: Q96MH2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ELVRDYLELEKRLSQAEEETRRLQQLQACTGQQSCRQVEELAAEVQRLRTENQRLRQENQMWNREGCRCDEEPGT
• Gene Sequence: ELVRDYLELEKRLSQAEEETRRLQQLQACTGQQSCRQVEELAAEVQRLRTENQRLRQENQMWNREGCRCDEEPGT
• Gene ID - Mouse: ENSMUSG00000043372
• Gene ID - Rat: ENSRNOG00000021287
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.