Anti HEXIM1 pAb (ATL-HPA008926)

Atlas Antibodies

Catalog No.: ATL-HPA008926-25

Protein Description: hexamethylene bis-acetamide inducible 1
Gene Name: HEXIM1
Alternative Gene Name: CLP-1, EDG1, HIS1, MAQ1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000048878: 95%, ENSRNOG00000003203: 94%
Entrez Gene ID: 10614
Uniprot ID: O94992
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: AKSDDTSDDDFMEEGGEEDGGSDGMGGDGSEFLQRDFSETYERYHTESLQNMSKQELIKEYLELEKCLSRMEDENNRLRLESKRLGGDDARVRELELELDRLRAENLQLLTENELHRQQERA
• Gene Sequence: AKSDDTSDDDFMEEGGEEDGGSDGMGGDGSEFLQRDFSETYERYHTESLQNMSKQELIKEYLELEKCLSRMEDENNRLRLESKRLGGDDARVRELELELDRLRAENLQLLTENELHRQQERA
• Gene ID - Mouse: ENSMUSG00000048878
• Gene ID - Rat: ENSRNOG00000003203
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.