Anti HEXIM1 pAb (ATL-HPA008926)

Atlas Antibodies

SKU:
ATL-HPA008926-25
  • Immunohistochemical staining of human skeletal muscle shows strong nuclear positivity in myocytes.
  • Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm.
  • Western blot analysis in control (vector only transfected HEK293T lysate) and HEXIM1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY416644).
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: hexamethylene bis-acetamide inducible 1
Gene Name: HEXIM1
Alternative Gene Name: CLP-1, EDG1, HIS1, MAQ1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000048878: 95%, ENSRNOG00000003203: 94%
Entrez Gene ID: 10614
Uniprot ID: O94992
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen AKSDDTSDDDFMEEGGEEDGGSDGMGGDGSEFLQRDFSETYERYHTESLQNMSKQELIKEYLELEKCLSRMEDENNRLRLESKRLGGDDARVRELELELDRLRAENLQLLTENELHRQQERA
Gene Sequence AKSDDTSDDDFMEEGGEEDGGSDGMGGDGSEFLQRDFSETYERYHTESLQNMSKQELIKEYLELEKCLSRMEDENNRLRLESKRLGGDDARVRELELELDRLRAENLQLLTENELHRQQERA
Gene ID - Mouse ENSMUSG00000048878
Gene ID - Rat ENSRNOG00000003203
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti HEXIM1 pAb (ATL-HPA008926)
Datasheet Anti HEXIM1 pAb (ATL-HPA008926) Datasheet (External Link)
Vendor Page Anti HEXIM1 pAb (ATL-HPA008926) at Atlas Antibodies

Documents & Links for Anti HEXIM1 pAb (ATL-HPA008926)
Datasheet Anti HEXIM1 pAb (ATL-HPA008926) Datasheet (External Link)
Vendor Page Anti HEXIM1 pAb (ATL-HPA008926)