Anti HES1 pAb (ATL-HPA066929)

Atlas Antibodies

Catalog No.: ATL-HPA066929-25

Protein Description: hes family bHLH transcription factor 1
Gene Name: HES1
Alternative Gene Name: bHLHb39, FLJ20408, HES-1, Hes1, HRY
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022528: 99%, ENSRNOG00000001720: 97%
Entrez Gene ID: 3280
Uniprot ID: Q14469
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PPLVPIPGGAAPPPGGAPCKLGSQAGEAAKVFGGFQVVPAPDGQFAFLIPNGAFAHSGPVIPVYTSNSG
• Gene Sequence: PPLVPIPGGAAPPPGGAPCKLGSQAGEAAKVFGGFQVVPAPDGQFAFLIPNGAFAHSGPVIPVYTSNSG
• Gene ID - Mouse: ENSMUSG00000022528
• Gene ID - Rat: ENSRNOG00000001720
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.