Anti HES1 pAb (ATL-HPA066929)
Atlas Antibodies
- Catalog No.:
- ATL-HPA066929-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: HES1
Alternative Gene Name: bHLHb39, FLJ20408, HES-1, Hes1, HRY
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022528: 99%, ENSRNOG00000001720: 97%
Entrez Gene ID: 3280
Uniprot ID: Q14469
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | PPLVPIPGGAAPPPGGAPCKLGSQAGEAAKVFGGFQVVPAPDGQFAFLIPNGAFAHSGPVIPVYTSNSG |
Gene Sequence | PPLVPIPGGAAPPPGGAPCKLGSQAGEAAKVFGGFQVVPAPDGQFAFLIPNGAFAHSGPVIPVYTSNSG |
Gene ID - Mouse | ENSMUSG00000022528 |
Gene ID - Rat | ENSRNOG00000001720 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti HES1 pAb (ATL-HPA066929) | |
Datasheet | Anti HES1 pAb (ATL-HPA066929) Datasheet (External Link) |
Vendor Page | Anti HES1 pAb (ATL-HPA066929) at Atlas Antibodies |
Documents & Links for Anti HES1 pAb (ATL-HPA066929) | |
Datasheet | Anti HES1 pAb (ATL-HPA066929) Datasheet (External Link) |
Vendor Page | Anti HES1 pAb (ATL-HPA066929) |