Anti HERC4 pAb (ATL-HPA070301)
Atlas Antibodies
- SKU:
- ATL-HPA070301-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: HERC4
Alternative Gene Name: DKFZP564G092, KIAA1593
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020064: 95%, ENSRNOG00000061040: 96%
Entrez Gene ID: 26091
Uniprot ID: Q5GLZ8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | GNASFGQLGLGGIDEEIVLEPRKSDFFINKRVRDVGCGLRHTVFVLDDGTVYTCGCNDLGQLGHEKSRKKPEQV |
Gene Sequence | GNASFGQLGLGGIDEEIVLEPRKSDFFINKRVRDVGCGLRHTVFVLDDGTVYTCGCNDLGQLGHEKSRKKPEQV |
Gene ID - Mouse | ENSMUSG00000020064 |
Gene ID - Rat | ENSRNOG00000061040 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti HERC4 pAb (ATL-HPA070301) | |
Datasheet | Anti HERC4 pAb (ATL-HPA070301) Datasheet (External Link) |
Vendor Page | Anti HERC4 pAb (ATL-HPA070301) at Atlas Antibodies |
Documents & Links for Anti HERC4 pAb (ATL-HPA070301) | |
Datasheet | Anti HERC4 pAb (ATL-HPA070301) Datasheet (External Link) |
Vendor Page | Anti HERC4 pAb (ATL-HPA070301) |