Anti HERC2 pAb (ATL-HPA048389)

Atlas Antibodies

Catalog No.: ATL-HPA048389-25

Protein Description: HECT and RLD domain containing E3 ubiquitin protein ligase 2
Gene Name: HERC2
Alternative Gene Name: D15F37S1, jdf2, p528
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030451: 83%, ENSRNOG00000013718: 85%
Entrez Gene ID: 8924
Uniprot ID: O95714
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LTGASGNASGLPGVEALVGWLLDHSDIQVTELSDADTVSDEYSDEEVVEDMDDAAYSMSTGAVVTESQTYK
• Gene Sequence: LTGASGNASGLPGVEALVGWLLDHSDIQVTELSDADTVSDEYSDEEVVEDMDDAAYSMSTGAVVTESQTYK
• Gene ID - Mouse: ENSMUSG00000030451
• Gene ID - Rat: ENSRNOG00000013718
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.