Anti HERC2 pAb (ATL-HPA048389)
Atlas Antibodies
- Catalog No.:
- ATL-HPA048389-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: HERC2
Alternative Gene Name: D15F37S1, jdf2, p528
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030451: 83%, ENSRNOG00000013718: 85%
Entrez Gene ID: 8924
Uniprot ID: O95714
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | LTGASGNASGLPGVEALVGWLLDHSDIQVTELSDADTVSDEYSDEEVVEDMDDAAYSMSTGAVVTESQTYK |
| Gene Sequence | LTGASGNASGLPGVEALVGWLLDHSDIQVTELSDADTVSDEYSDEEVVEDMDDAAYSMSTGAVVTESQTYK |
| Gene ID - Mouse | ENSMUSG00000030451 |
| Gene ID - Rat | ENSRNOG00000013718 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti HERC2 pAb (ATL-HPA048389) | |
| Datasheet | Anti HERC2 pAb (ATL-HPA048389) Datasheet (External Link) |
| Vendor Page | Anti HERC2 pAb (ATL-HPA048389) at Atlas Antibodies |
| Documents & Links for Anti HERC2 pAb (ATL-HPA048389) | |
| Datasheet | Anti HERC2 pAb (ATL-HPA048389) Datasheet (External Link) |
| Vendor Page | Anti HERC2 pAb (ATL-HPA048389) |