Anti HELLS pAb (ATL-HPA063242 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA063242-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: HELLS
Alternative Gene Name: LSH, Nbla10143, PASG, SMARCA6
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025001: 85%, ENSRNOG00000047692: 85%
Entrez Gene ID: 3070
Uniprot ID: Q9NRZ9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | VVYAPLSKKQEIFYTAIVNRTIANMFGSSEKETIELSPTGRPKRRTRKSINYSKIDDFPNELEKLISQIQPEVDRERAVVEVNIPV |
| Gene Sequence | VVYAPLSKKQEIFYTAIVNRTIANMFGSSEKETIELSPTGRPKRRTRKSINYSKIDDFPNELEKLISQIQPEVDRERAVVEVNIPV |
| Gene ID - Mouse | ENSMUSG00000025001 |
| Gene ID - Rat | ENSRNOG00000047692 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti HELLS pAb (ATL-HPA063242 w/enhanced validation) | |
| Datasheet | Anti HELLS pAb (ATL-HPA063242 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti HELLS pAb (ATL-HPA063242 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti HELLS pAb (ATL-HPA063242 w/enhanced validation) | |
| Datasheet | Anti HELLS pAb (ATL-HPA063242 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti HELLS pAb (ATL-HPA063242 w/enhanced validation) |
| Citations for Anti HELLS pAb (ATL-HPA063242 w/enhanced validation) – 1 Found |
| Määttä, Tomi A; Rettel, Mandy; Sridharan, Sindhuja; Helm, Dominic; Kurzawa, Nils; Stein, Frank; Savitski, Mikhail M. Aggregation and disaggregation features of the human proteome. Molecular Systems Biology. 2020;16(10):e9500. PubMed |