Anti HECW1 pAb (ATL-HPA007593)

Atlas Antibodies

SKU: ATL-HPA007593-25

• 

Protein Description: HECT, C2 and WW domain containing E3 ubiquitin protein ligase 1
Gene Name: HECW1
Alternative Gene Name: KIAA0322, NEDL1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021301: 80%, ENSRNOG00000016046: 78%
Entrez Gene ID: 23072
Uniprot ID: Q76N89
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: EEEEKEQEEEGDVSTLEQGEGRLQLRASVKRKSRPCSLPVSELETVIASACGDPETPRTHYIRIHTLLHSMPSAQGGSAAEEEDGAEEESTLKDSSEKDGLSEVDTVAADPSALE
• Gene Sequence: EEEEKEQEEEGDVSTLEQGEGRLQLRASVKRKSRPCSLPVSELETVIASACGDPETPRTHYIRIHTLLHSMPSAQGGSAAEEEDGAEEESTLKDSSEKDGLSEVDTVAADPSALE
• Gene ID - Mouse: ENSMUSG00000021301
• Gene ID - Rat: ENSRNOG00000016046
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.