Anti HECW1 pAb (ATL-HPA007593)

Atlas Antibodies

Catalog No.:
ATL-HPA007593-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: HECT, C2 and WW domain containing E3 ubiquitin protein ligase 1
Gene Name: HECW1
Alternative Gene Name: KIAA0322, NEDL1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021301: 80%, ENSRNOG00000016046: 78%
Entrez Gene ID: 23072
Uniprot ID: Q76N89
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EEEEKEQEEEGDVSTLEQGEGRLQLRASVKRKSRPCSLPVSELETVIASACGDPETPRTHYIRIHTLLHSMPSAQGGSAAEEEDGAEEESTLKDSSEKDGLSEVDTVAADPSALE
Gene Sequence EEEEKEQEEEGDVSTLEQGEGRLQLRASVKRKSRPCSLPVSELETVIASACGDPETPRTHYIRIHTLLHSMPSAQGGSAAEEEDGAEEESTLKDSSEKDGLSEVDTVAADPSALE
Gene ID - Mouse ENSMUSG00000021301
Gene ID - Rat ENSRNOG00000016046
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti HECW1 pAb (ATL-HPA007593)
Datasheet Anti HECW1 pAb (ATL-HPA007593) Datasheet (External Link)
Vendor Page Anti HECW1 pAb (ATL-HPA007593) at Atlas Antibodies

Documents & Links for Anti HECW1 pAb (ATL-HPA007593)
Datasheet Anti HECW1 pAb (ATL-HPA007593) Datasheet (External Link)
Vendor Page Anti HECW1 pAb (ATL-HPA007593)