Anti HECW1 pAb (ATL-HPA007593)
Atlas Antibodies
- Catalog No.:
- ATL-HPA007593-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: HECW1
Alternative Gene Name: KIAA0322, NEDL1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021301: 80%, ENSRNOG00000016046: 78%
Entrez Gene ID: 23072
Uniprot ID: Q76N89
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | EEEEKEQEEEGDVSTLEQGEGRLQLRASVKRKSRPCSLPVSELETVIASACGDPETPRTHYIRIHTLLHSMPSAQGGSAAEEEDGAEEESTLKDSSEKDGLSEVDTVAADPSALE |
| Gene Sequence | EEEEKEQEEEGDVSTLEQGEGRLQLRASVKRKSRPCSLPVSELETVIASACGDPETPRTHYIRIHTLLHSMPSAQGGSAAEEEDGAEEESTLKDSSEKDGLSEVDTVAADPSALE |
| Gene ID - Mouse | ENSMUSG00000021301 |
| Gene ID - Rat | ENSRNOG00000016046 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti HECW1 pAb (ATL-HPA007593) | |
| Datasheet | Anti HECW1 pAb (ATL-HPA007593) Datasheet (External Link) |
| Vendor Page | Anti HECW1 pAb (ATL-HPA007593) at Atlas Antibodies |
| Documents & Links for Anti HECW1 pAb (ATL-HPA007593) | |
| Datasheet | Anti HECW1 pAb (ATL-HPA007593) Datasheet (External Link) |
| Vendor Page | Anti HECW1 pAb (ATL-HPA007593) |