Anti HECTD4 pAb (ATL-HPA041062)

Atlas Antibodies

Catalog No.:
ATL-HPA041062-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: HECT domain containing E3 ubiquitin protein ligase 4
Gene Name: HECTD4
Alternative Gene Name: C12orf51, FLJ34154, KIAA0614
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042744: 99%, ENSRNOG00000001352: 99%
Entrez Gene ID: 283450
Uniprot ID:
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KETVHIPGARCLYLRFDSRCSSQYDYDKLVIYAGPNTNSRKVAEYGGNTLGYGSRSVLGTGWPKDLVKVEGDTVTFSFEMRSGREHNTPDKAMWGFACTVR
Gene Sequence KETVHIPGARCLYLRFDSRCSSQYDYDKLVIYAGPNTNSRKVAEYGGNTLGYGSRSVLGTGWPKDLVKVEGDTVTFSFEMRSGREHNTPDKAMWGFACTVR
Gene ID - Mouse ENSMUSG00000042744
Gene ID - Rat ENSRNOG00000001352
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti HECTD4 pAb (ATL-HPA041062)
Datasheet Anti HECTD4 pAb (ATL-HPA041062) Datasheet (External Link)
Vendor Page Anti HECTD4 pAb (ATL-HPA041062) at Atlas Antibodies

Documents & Links for Anti HECTD4 pAb (ATL-HPA041062)
Datasheet Anti HECTD4 pAb (ATL-HPA041062) Datasheet (External Link)
Vendor Page Anti HECTD4 pAb (ATL-HPA041062)