Anti HECTD3 pAb (ATL-HPA027467)
Atlas Antibodies
- Catalog No.:
- ATL-HPA027467-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: HECTD3
Alternative Gene Name: FLJ21156
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000046861: 98%, ENSRNOG00000018363: 99%
Entrez Gene ID: 79654
Uniprot ID: Q5T447
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | VVDLTYSHRLGSRPQPAEAYAEAVQRLLYVPPTWTYECDEDLIHFLYDHLGKEDENLGSVKQYVESIDVSSYTEEFNVSCLTDSNADTY |
Gene Sequence | VVDLTYSHRLGSRPQPAEAYAEAVQRLLYVPPTWTYECDEDLIHFLYDHLGKEDENLGSVKQYVESIDVSSYTEEFNVSCLTDSNADTY |
Gene ID - Mouse | ENSMUSG00000046861 |
Gene ID - Rat | ENSRNOG00000018363 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti HECTD3 pAb (ATL-HPA027467) | |
Datasheet | Anti HECTD3 pAb (ATL-HPA027467) Datasheet (External Link) |
Vendor Page | Anti HECTD3 pAb (ATL-HPA027467) at Atlas Antibodies |
Documents & Links for Anti HECTD3 pAb (ATL-HPA027467) | |
Datasheet | Anti HECTD3 pAb (ATL-HPA027467) Datasheet (External Link) |
Vendor Page | Anti HECTD3 pAb (ATL-HPA027467) |