Anti HECTD3 pAb (ATL-HPA027467)

Atlas Antibodies

SKU: ATL-HPA027467-25

• 

Protein Description: HECT domain containing E3 ubiquitin protein ligase 3
Gene Name: HECTD3
Alternative Gene Name: FLJ21156
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000046861: 98%, ENSRNOG00000018363: 99%
Entrez Gene ID: 79654
Uniprot ID: Q5T447
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VVDLTYSHRLGSRPQPAEAYAEAVQRLLYVPPTWTYECDEDLIHFLYDHLGKEDENLGSVKQYVESIDVSSYTEEFNVSCLTDSNADTY
• Gene Sequence: VVDLTYSHRLGSRPQPAEAYAEAVQRLLYVPPTWTYECDEDLIHFLYDHLGKEDENLGSVKQYVESIDVSSYTEEFNVSCLTDSNADTY
• Gene ID - Mouse: ENSMUSG00000046861
• Gene ID - Rat: ENSRNOG00000018363
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.