Anti HECTD3 pAb (ATL-HPA027467)

Atlas Antibodies

Catalog No.:
ATL-HPA027467-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: HECT domain containing E3 ubiquitin protein ligase 3
Gene Name: HECTD3
Alternative Gene Name: FLJ21156
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000046861: 98%, ENSRNOG00000018363: 99%
Entrez Gene ID: 79654
Uniprot ID: Q5T447
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VVDLTYSHRLGSRPQPAEAYAEAVQRLLYVPPTWTYECDEDLIHFLYDHLGKEDENLGSVKQYVESIDVSSYTEEFNVSCLTDSNADTY
Gene Sequence VVDLTYSHRLGSRPQPAEAYAEAVQRLLYVPPTWTYECDEDLIHFLYDHLGKEDENLGSVKQYVESIDVSSYTEEFNVSCLTDSNADTY
Gene ID - Mouse ENSMUSG00000046861
Gene ID - Rat ENSRNOG00000018363
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti HECTD3 pAb (ATL-HPA027467)
Datasheet Anti HECTD3 pAb (ATL-HPA027467) Datasheet (External Link)
Vendor Page Anti HECTD3 pAb (ATL-HPA027467) at Atlas Antibodies

Documents & Links for Anti HECTD3 pAb (ATL-HPA027467)
Datasheet Anti HECTD3 pAb (ATL-HPA027467) Datasheet (External Link)
Vendor Page Anti HECTD3 pAb (ATL-HPA027467)