Anti HECTD2 pAb (ATL-HPA037767)
Atlas Antibodies
- Catalog No.:
- ATL-HPA037767-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: HECTD2
Alternative Gene Name: FLJ37306
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041180: 67%, ENSRNOG00000056753: 71%
Entrez Gene ID: 143279
Uniprot ID: Q5U5R9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | SPAHLVFPNIKNVREPPPICLDVRQKQRTSMDASSSEMKAPVLPEPILPIQPKTVKDFQEDVEKVKSSGDWKA |
| Gene Sequence | SPAHLVFPNIKNVREPPPICLDVRQKQRTSMDASSSEMKAPVLPEPILPIQPKTVKDFQEDVEKVKSSGDWKA |
| Gene ID - Mouse | ENSMUSG00000041180 |
| Gene ID - Rat | ENSRNOG00000056753 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti HECTD2 pAb (ATL-HPA037767) | |
| Datasheet | Anti HECTD2 pAb (ATL-HPA037767) Datasheet (External Link) |
| Vendor Page | Anti HECTD2 pAb (ATL-HPA037767) at Atlas Antibodies |
| Documents & Links for Anti HECTD2 pAb (ATL-HPA037767) | |
| Datasheet | Anti HECTD2 pAb (ATL-HPA037767) Datasheet (External Link) |
| Vendor Page | Anti HECTD2 pAb (ATL-HPA037767) |
| Citations for Anti HECTD2 pAb (ATL-HPA037767) – 2 Found |
| Lv, Dong; Shen, Taimin; Yao, Juncheng; Yang, Qi; Xiang, Ying; Ma, Zhiwei. HIF-1α Induces HECTD2 Up-Regulation and Aggravates the Malignant Progression of Renal Cell Cancer via Repressing miR-320a. Frontiers In Cell And Developmental Biology. 9( 35004677):775642. PubMed |
| Edfors, Fredrik; Boström, Tove; Forsström, Björn; Zeiler, Marlis; Johansson, Henrik; Lundberg, Emma; Hober, Sophia; Lehtiö, Janne; Mann, Matthias; Uhlen, Mathias. Immunoproteomics using polyclonal antibodies and stable isotope-labeled affinity-purified recombinant proteins. Molecular & Cellular Proteomics : Mcp. 2014;13(6):1611-24. PubMed |