Anti HECTD2 pAb (ATL-HPA037767)

Atlas Antibodies

Catalog No.:
ATL-HPA037767-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: HECT domain containing E3 ubiquitin protein ligase 2
Gene Name: HECTD2
Alternative Gene Name: FLJ37306
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041180: 67%, ENSRNOG00000056753: 71%
Entrez Gene ID: 143279
Uniprot ID: Q5U5R9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SPAHLVFPNIKNVREPPPICLDVRQKQRTSMDASSSEMKAPVLPEPILPIQPKTVKDFQEDVEKVKSSGDWKA
Gene Sequence SPAHLVFPNIKNVREPPPICLDVRQKQRTSMDASSSEMKAPVLPEPILPIQPKTVKDFQEDVEKVKSSGDWKA
Gene ID - Mouse ENSMUSG00000041180
Gene ID - Rat ENSRNOG00000056753
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti HECTD2 pAb (ATL-HPA037767)
Datasheet Anti HECTD2 pAb (ATL-HPA037767) Datasheet (External Link)
Vendor Page Anti HECTD2 pAb (ATL-HPA037767) at Atlas Antibodies

Documents & Links for Anti HECTD2 pAb (ATL-HPA037767)
Datasheet Anti HECTD2 pAb (ATL-HPA037767) Datasheet (External Link)
Vendor Page Anti HECTD2 pAb (ATL-HPA037767)
Citations for Anti HECTD2 pAb (ATL-HPA037767) – 2 Found
Lv, Dong; Shen, Taimin; Yao, Juncheng; Yang, Qi; Xiang, Ying; Ma, Zhiwei. HIF-1α Induces HECTD2 Up-Regulation and Aggravates the Malignant Progression of Renal Cell Cancer via Repressing miR-320a. Frontiers In Cell And Developmental Biology. 9( 35004677):775642.  PubMed
Edfors, Fredrik; Boström, Tove; Forsström, Björn; Zeiler, Marlis; Johansson, Henrik; Lundberg, Emma; Hober, Sophia; Lehtiö, Janne; Mann, Matthias; Uhlen, Mathias. Immunoproteomics using polyclonal antibodies and stable isotope-labeled affinity-purified recombinant proteins. Molecular & Cellular Proteomics : Mcp. 2014;13(6):1611-24.  PubMed