Anti HECTD1 pAb (ATL-HPA054461)

Atlas Antibodies

Catalog No.:
ATL-HPA054461-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: HECT domain containing E3 ubiquitin protein ligase 1
Gene Name: HECTD1
Alternative Gene Name: KIAA1131
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035247: 98%, ENSRNOG00000006905: 98%
Entrez Gene ID: 25831
Uniprot ID: Q9ULT8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RHQHDFDENGIIYWIGTNAKTAYEWVNPAAYGLVVVTSSEGRNLPYGRLEDILSRDNSALNCHSNDDKNAWFAIDLGLWVIPSAYTLRHARGYGRSALRNWVFQVSKDGQDW
Gene Sequence RHQHDFDENGIIYWIGTNAKTAYEWVNPAAYGLVVVTSSEGRNLPYGRLEDILSRDNSALNCHSNDDKNAWFAIDLGLWVIPSAYTLRHARGYGRSALRNWVFQVSKDGQDW
Gene ID - Mouse ENSMUSG00000035247
Gene ID - Rat ENSRNOG00000006905
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti HECTD1 pAb (ATL-HPA054461)
Datasheet Anti HECTD1 pAb (ATL-HPA054461) Datasheet (External Link)
Vendor Page Anti HECTD1 pAb (ATL-HPA054461) at Atlas Antibodies

Documents & Links for Anti HECTD1 pAb (ATL-HPA054461)
Datasheet Anti HECTD1 pAb (ATL-HPA054461) Datasheet (External Link)
Vendor Page Anti HECTD1 pAb (ATL-HPA054461)