Anti HECTD1 pAb (ATL-HPA002929)
Atlas Antibodies
- Catalog No.:
- ATL-HPA002929-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: HECTD1
Alternative Gene Name: KIAA1131
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035247: 97%, ENSRNOG00000006905: 96%
Entrez Gene ID: 25831
Uniprot ID: Q9ULT8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | RHWKLTGTNKSIRKNRNCSQLIAAYKDFCEHGTKSGLNQGAISTLQSSDILNLTKEQPQAKAGNGQNSCGVEDVLQLLRILYIVASDPYSRISQEDGDEQPQFTFPPDE |
Gene Sequence | RHWKLTGTNKSIRKNRNCSQLIAAYKDFCEHGTKSGLNQGAISTLQSSDILNLTKEQPQAKAGNGQNSCGVEDVLQLLRILYIVASDPYSRISQEDGDEQPQFTFPPDE |
Gene ID - Mouse | ENSMUSG00000035247 |
Gene ID - Rat | ENSRNOG00000006905 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti HECTD1 pAb (ATL-HPA002929) | |
Datasheet | Anti HECTD1 pAb (ATL-HPA002929) Datasheet (External Link) |
Vendor Page | Anti HECTD1 pAb (ATL-HPA002929) at Atlas Antibodies |
Documents & Links for Anti HECTD1 pAb (ATL-HPA002929) | |
Datasheet | Anti HECTD1 pAb (ATL-HPA002929) Datasheet (External Link) |
Vendor Page | Anti HECTD1 pAb (ATL-HPA002929) |
Citations for Anti HECTD1 pAb (ATL-HPA002929) – 1 Found |
Wang, Xinggang; De Geyter, Christian; Jia, Zanhui; Peng, Ya; Zhang, Hong. HECTD1 regulates the expression of SNAIL: Implications for epithelial‑mesenchymal transition. International Journal Of Oncology. 2020;56(5):1186-1198. PubMed |