Anti HECTD1 pAb (ATL-HPA002929)

Atlas Antibodies

Catalog No.: ATL-HPA002929-25

Protein Description: HECT domain containing E3 ubiquitin protein ligase 1
Gene Name: HECTD1
Alternative Gene Name: KIAA1131
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035247: 97%, ENSRNOG00000006905: 96%
Entrez Gene ID: 25831
Uniprot ID: Q9ULT8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RHWKLTGTNKSIRKNRNCSQLIAAYKDFCEHGTKSGLNQGAISTLQSSDILNLTKEQPQAKAGNGQNSCGVEDVLQLLRILYIVASDPYSRISQEDGDEQPQFTFPPDE
• Gene Sequence: RHWKLTGTNKSIRKNRNCSQLIAAYKDFCEHGTKSGLNQGAISTLQSSDILNLTKEQPQAKAGNGQNSCGVEDVLQLLRILYIVASDPYSRISQEDGDEQPQFTFPPDE
• Gene ID - Mouse: ENSMUSG00000035247
• Gene ID - Rat: ENSRNOG00000006905
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti HECTD1 pAb (ATL-HPA002929) – 1 Found

Wang, Xinggang; De Geyter, Christian; Jia, Zanhui; Peng, Ya; Zhang, Hong. HECTD1 regulates the expression of SNAIL: Implications for epithelial‑mesenchymal transition. International Journal Of Oncology. 2020;56(5):1186-1198.