Anti HECTD1 pAb (ATL-HPA002929)

Atlas Antibodies

Catalog No.:
ATL-HPA002929-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: HECT domain containing E3 ubiquitin protein ligase 1
Gene Name: HECTD1
Alternative Gene Name: KIAA1131
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035247: 97%, ENSRNOG00000006905: 96%
Entrez Gene ID: 25831
Uniprot ID: Q9ULT8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RHWKLTGTNKSIRKNRNCSQLIAAYKDFCEHGTKSGLNQGAISTLQSSDILNLTKEQPQAKAGNGQNSCGVEDVLQLLRILYIVASDPYSRISQEDGDEQPQFTFPPDE
Gene Sequence RHWKLTGTNKSIRKNRNCSQLIAAYKDFCEHGTKSGLNQGAISTLQSSDILNLTKEQPQAKAGNGQNSCGVEDVLQLLRILYIVASDPYSRISQEDGDEQPQFTFPPDE
Gene ID - Mouse ENSMUSG00000035247
Gene ID - Rat ENSRNOG00000006905
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti HECTD1 pAb (ATL-HPA002929)
Datasheet Anti HECTD1 pAb (ATL-HPA002929) Datasheet (External Link)
Vendor Page Anti HECTD1 pAb (ATL-HPA002929) at Atlas Antibodies

Documents & Links for Anti HECTD1 pAb (ATL-HPA002929)
Datasheet Anti HECTD1 pAb (ATL-HPA002929) Datasheet (External Link)
Vendor Page Anti HECTD1 pAb (ATL-HPA002929)
Citations for Anti HECTD1 pAb (ATL-HPA002929) – 1 Found
Wang, Xinggang; De Geyter, Christian; Jia, Zanhui; Peng, Ya; Zhang, Hong. HECTD1 regulates the expression of SNAIL: Implications for epithelial‑mesenchymal transition. International Journal Of Oncology. 2020;56(5):1186-1198.  PubMed