Anti HEBP1 pAb (ATL-HPA075277)

Atlas Antibodies

Catalog No.:
ATL-HPA075277-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: heme binding protein 1
Gene Name: HEBP1
Alternative Gene Name: HBP, HEBP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042770: 87%, ENSRNOG00000000024: 87%
Entrez Gene ID: 50865
Uniprot ID: Q9NRV9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EVAYEERACEGGKFATVEVTDKPVDEALREAMPKVAKYA
Gene Sequence EVAYEERACEGGKFATVEVTDKPVDEALREAMPKVAKYA
Gene ID - Mouse ENSMUSG00000042770
Gene ID - Rat ENSRNOG00000000024
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti HEBP1 pAb (ATL-HPA075277)
Datasheet Anti HEBP1 pAb (ATL-HPA075277) Datasheet (External Link)
Vendor Page Anti HEBP1 pAb (ATL-HPA075277) at Atlas Antibodies

Documents & Links for Anti HEBP1 pAb (ATL-HPA075277)
Datasheet Anti HEBP1 pAb (ATL-HPA075277) Datasheet (External Link)
Vendor Page Anti HEBP1 pAb (ATL-HPA075277)