Anti HEBP1 pAb (ATL-HPA056417)

Atlas Antibodies

Catalog No.: ATL-HPA056417-25

Protein Description: heme binding protein 1
Gene Name: HEBP1
Alternative Gene Name: HBP, HEBP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042770: 91%, ENSRNOG00000000024: 91%
Entrez Gene ID: 50865
Uniprot ID: Q9NRV9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: TNDKGIGMGMTVPISFAVFPNEDGSLQKKLKVWFRIPNQFQSDPPAPSDKSVKIEERE
• Gene Sequence: TNDKGIGMGMTVPISFAVFPNEDGSLQKKLKVWFRIPNQFQSDPPAPSDKSVKIEERE
• Gene ID - Mouse: ENSMUSG00000042770
• Gene ID - Rat: ENSRNOG00000000024
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.