Anti HEBP1 pAb (ATL-HPA056417)
Atlas Antibodies
- Catalog No.:
- ATL-HPA056417-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: HEBP1
Alternative Gene Name: HBP, HEBP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042770: 91%, ENSRNOG00000000024: 91%
Entrez Gene ID: 50865
Uniprot ID: Q9NRV9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | TNDKGIGMGMTVPISFAVFPNEDGSLQKKLKVWFRIPNQFQSDPPAPSDKSVKIEERE |
Gene Sequence | TNDKGIGMGMTVPISFAVFPNEDGSLQKKLKVWFRIPNQFQSDPPAPSDKSVKIEERE |
Gene ID - Mouse | ENSMUSG00000042770 |
Gene ID - Rat | ENSRNOG00000000024 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti HEBP1 pAb (ATL-HPA056417) | |
Datasheet | Anti HEBP1 pAb (ATL-HPA056417) Datasheet (External Link) |
Vendor Page | Anti HEBP1 pAb (ATL-HPA056417) at Atlas Antibodies |
Documents & Links for Anti HEBP1 pAb (ATL-HPA056417) | |
Datasheet | Anti HEBP1 pAb (ATL-HPA056417) Datasheet (External Link) |
Vendor Page | Anti HEBP1 pAb (ATL-HPA056417) |