Anti HEATR5B pAb (ATL-HPA055639)

Atlas Antibodies

Catalog No.:
ATL-HPA055639-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: HEAT repeat containing 5B
Gene Name: HEATR5B
Alternative Gene Name: DKFZp686P15184, KIAA1414
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039414: 100%, ENSRNOG00000025926: 97%
Entrez Gene ID: 54497
Uniprot ID: Q9P2D3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DQLQPNSASGSGALEHDPSSIYLRIPAGEAVPGPLPLGVSVIDASVALFGVVFPHVSYKHRLQMLDHFAECVKQAKGV
Gene Sequence DQLQPNSASGSGALEHDPSSIYLRIPAGEAVPGPLPLGVSVIDASVALFGVVFPHVSYKHRLQMLDHFAECVKQAKGV
Gene ID - Mouse ENSMUSG00000039414
Gene ID - Rat ENSRNOG00000025926
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti HEATR5B pAb (ATL-HPA055639)
Datasheet Anti HEATR5B pAb (ATL-HPA055639) Datasheet (External Link)
Vendor Page Anti HEATR5B pAb (ATL-HPA055639) at Atlas Antibodies

Documents & Links for Anti HEATR5B pAb (ATL-HPA055639)
Datasheet Anti HEATR5B pAb (ATL-HPA055639) Datasheet (External Link)
Vendor Page Anti HEATR5B pAb (ATL-HPA055639)
Citations for Anti HEATR5B pAb (ATL-HPA055639) – 1 Found
Ghosh, Shereen G; Breuss, Martin W; Schlachetzki, Zinayida; Chai, Guoliang; Ross, Danica; Stanley, Valentina; Sonmez, F Mujgan; Topaloglu, Haluk; Zaki, Maha S; Hosny, Heba; Gad, Shaimaa; Gleeson, Joseph G. Biallelic hypomorphic mutations in HEATR5B, encoding HEAT repeat-containing protein 5B, in a neurological syndrome with pontocerebellar hypoplasia. European Journal Of Human Genetics : Ejhg. 2021;29(6):957-964.  PubMed