Anti HEATR5A pAb (ATL-HPA049539)

Atlas Antibodies

Catalog No.:
ATL-HPA049539-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: HEAT repeat containing 5A
Gene Name: HEATR5A
Alternative Gene Name: C14orf125, DKFZP434I1735
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035181: 87%, ENSRNOG00000006483: 90%
Entrez Gene ID: 25938
Uniprot ID:
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VTQRLLPPLPCAVDLLTQLSSILKMYGSPLKTPSVVYRQRLYELLILLPPETYEGNLCAILRELAADLTAPDIQVAAS
Gene Sequence VTQRLLPPLPCAVDLLTQLSSILKMYGSPLKTPSVVYRQRLYELLILLPPETYEGNLCAILRELAADLTAPDIQVAAS
Gene ID - Mouse ENSMUSG00000035181
Gene ID - Rat ENSRNOG00000006483
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti HEATR5A pAb (ATL-HPA049539)
Datasheet Anti HEATR5A pAb (ATL-HPA049539) Datasheet (External Link)
Vendor Page Anti HEATR5A pAb (ATL-HPA049539) at Atlas Antibodies

Documents & Links for Anti HEATR5A pAb (ATL-HPA049539)
Datasheet Anti HEATR5A pAb (ATL-HPA049539) Datasheet (External Link)
Vendor Page Anti HEATR5A pAb (ATL-HPA049539)