Anti HEATR5A pAb (ATL-HPA049539)

Atlas Antibodies

Catalog No.: ATL-HPA049539-25

Protein Description: HEAT repeat containing 5A
Gene Name: HEATR5A
Alternative Gene Name: C14orf125, DKFZP434I1735
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035181: 87%, ENSRNOG00000006483: 90%
Entrez Gene ID: 25938
Uniprot ID:
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VTQRLLPPLPCAVDLLTQLSSILKMYGSPLKTPSVVYRQRLYELLILLPPETYEGNLCAILRELAADLTAPDIQVAAS
• Gene Sequence: VTQRLLPPLPCAVDLLTQLSSILKMYGSPLKTPSVVYRQRLYELLILLPPETYEGNLCAILRELAADLTAPDIQVAAS
• Gene ID - Mouse: ENSMUSG00000035181
• Gene ID - Rat: ENSRNOG00000006483
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.