Anti HEATR3 pAb (ATL-HPA058579)

Atlas Antibodies

Catalog No.:
ATL-HPA058579-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: HEAT repeat containing 3
Gene Name: HEATR3
Alternative Gene Name: FLJ20718
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031657: 86%, ENSRNOG00000015459: 80%
Entrez Gene ID: 55027
Uniprot ID: Q7Z4Q2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TNGDDLIEDDEMEGISHKRRVRRKTFVSDLLPPTDKELRETIALLTAQQTALEIIVNMCCNEDPSDDEWEELSSSDE
Gene Sequence TNGDDLIEDDEMEGISHKRRVRRKTFVSDLLPPTDKELRETIALLTAQQTALEIIVNMCCNEDPSDDEWEELSSSDE
Gene ID - Mouse ENSMUSG00000031657
Gene ID - Rat ENSRNOG00000015459
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti HEATR3 pAb (ATL-HPA058579)
Datasheet Anti HEATR3 pAb (ATL-HPA058579) Datasheet (External Link)
Vendor Page Anti HEATR3 pAb (ATL-HPA058579) at Atlas Antibodies

Documents & Links for Anti HEATR3 pAb (ATL-HPA058579)
Datasheet Anti HEATR3 pAb (ATL-HPA058579) Datasheet (External Link)
Vendor Page Anti HEATR3 pAb (ATL-HPA058579)