Anti HEATR3 pAb (ATL-HPA058579)
Atlas Antibodies
- Catalog No.:
- ATL-HPA058579-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: HEATR3
Alternative Gene Name: FLJ20718
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031657: 86%, ENSRNOG00000015459: 80%
Entrez Gene ID: 55027
Uniprot ID: Q7Z4Q2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | TNGDDLIEDDEMEGISHKRRVRRKTFVSDLLPPTDKELRETIALLTAQQTALEIIVNMCCNEDPSDDEWEELSSSDE |
| Gene Sequence | TNGDDLIEDDEMEGISHKRRVRRKTFVSDLLPPTDKELRETIALLTAQQTALEIIVNMCCNEDPSDDEWEELSSSDE |
| Gene ID - Mouse | ENSMUSG00000031657 |
| Gene ID - Rat | ENSRNOG00000015459 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti HEATR3 pAb (ATL-HPA058579) | |
| Datasheet | Anti HEATR3 pAb (ATL-HPA058579) Datasheet (External Link) |
| Vendor Page | Anti HEATR3 pAb (ATL-HPA058579) at Atlas Antibodies |
| Documents & Links for Anti HEATR3 pAb (ATL-HPA058579) | |
| Datasheet | Anti HEATR3 pAb (ATL-HPA058579) Datasheet (External Link) |
| Vendor Page | Anti HEATR3 pAb (ATL-HPA058579) |