Anti HEATR1 pAb (ATL-HPA062200)

Atlas Antibodies

SKU:
ATL-HPA062200-25
  • Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoli fibrillar center & mitochondria.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: HEAT repeat containing 1
Gene Name: HEATR1
Alternative Gene Name: BAP28, FLJ10359, UTP10
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000050244: 78%, ENSRNOG00000047594: 82%
Entrez Gene ID: 55127
Uniprot ID: Q9H583
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen YDVSPLLHYMLPHLVVSIIHHVTGEETEGMDGQIYKRHLEAILTKISLKNNLDHLLASLLFEEYISYSSQEEMDSNKVSLLNEQFLPLIRLLESKYPRT
Gene Sequence YDVSPLLHYMLPHLVVSIIHHVTGEETEGMDGQIYKRHLEAILTKISLKNNLDHLLASLLFEEYISYSSQEEMDSNKVSLLNEQFLPLIRLLESKYPRT
Gene ID - Mouse ENSMUSG00000050244
Gene ID - Rat ENSRNOG00000047594
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti HEATR1 pAb (ATL-HPA062200)
Datasheet Anti HEATR1 pAb (ATL-HPA062200) Datasheet (External Link)
Vendor Page Anti HEATR1 pAb (ATL-HPA062200) at Atlas Antibodies

Documents & Links for Anti HEATR1 pAb (ATL-HPA062200)
Datasheet Anti HEATR1 pAb (ATL-HPA062200) Datasheet (External Link)
Vendor Page Anti HEATR1 pAb (ATL-HPA062200)