Anti HEATR1 pAb (ATL-HPA062200)

Atlas Antibodies

Catalog No.: ATL-HPA062200-25

Protein Description: HEAT repeat containing 1
Gene Name: HEATR1
Alternative Gene Name: BAP28, FLJ10359, UTP10
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000050244: 78%, ENSRNOG00000047594: 82%
Entrez Gene ID: 55127
Uniprot ID: Q9H583
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: YDVSPLLHYMLPHLVVSIIHHVTGEETEGMDGQIYKRHLEAILTKISLKNNLDHLLASLLFEEYISYSSQEEMDSNKVSLLNEQFLPLIRLLESKYPRT
• Gene Sequence: YDVSPLLHYMLPHLVVSIIHHVTGEETEGMDGQIYKRHLEAILTKISLKNNLDHLLASLLFEEYISYSSQEEMDSNKVSLLNEQFLPLIRLLESKYPRT
• Gene ID - Mouse: ENSMUSG00000050244
• Gene ID - Rat: ENSRNOG00000047594
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.