Anti HDDC2 pAb (ATL-HPA035677)

Atlas Antibodies

Catalog No.:
ATL-HPA035677-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: HD domain containing 2
Gene Name: HDDC2
Alternative Gene Name: C6orf74, CGI-130, dJ167O5.2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000000295: 83%, ENSRNOG00000021442: 83%
Entrez Gene ID: 51020
Uniprot ID: Q7Z4H3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MASVSSATFSGHGARSLLQFLLLVGQLKRVPRTGWVYRNVQRPESVSDHMYRMAVMAMVIKDDRLNKDRCVRLALVHDMAECIVGDIAPADNIPKEEKHRREEEAMKQITQLLP
Gene Sequence MASVSSATFSGHGARSLLQFLLLVGQLKRVPRTGWVYRNVQRPESVSDHMYRMAVMAMVIKDDRLNKDRCVRLALVHDMAECIVGDIAPADNIPKEEKHRREEEAMKQITQLLP
Gene ID - Mouse ENSMUSG00000000295
Gene ID - Rat ENSRNOG00000021442
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti HDDC2 pAb (ATL-HPA035677)
Datasheet Anti HDDC2 pAb (ATL-HPA035677) Datasheet (External Link)
Vendor Page Anti HDDC2 pAb (ATL-HPA035677) at Atlas Antibodies

Documents & Links for Anti HDDC2 pAb (ATL-HPA035677)
Datasheet Anti HDDC2 pAb (ATL-HPA035677) Datasheet (External Link)
Vendor Page Anti HDDC2 pAb (ATL-HPA035677)