Anti HDAC4 pAb (ATL-HPA071448)
Atlas Antibodies
- Catalog No.:
- ATL-HPA071448-25
- Shipping:
- Calculated at Checkout
$351.00
Gene Name: HDAC4
Alternative Gene Name: BDMR, HA6116, HD4, HDAC-4, HDAC-A, HDACA, KIAA0288
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026313: 91%, ENSRNOG00000020372: 93%
Entrez Gene ID: 9759
Uniprot ID: P56524
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | QDAERLTLPALQQRLSLFPGTHLTPYLSTSPLERDGGAAHSPLLQHMVLLEQPPAQAPLVTGLGALPLHAQSLVGADRVSPSIHKL |
| Gene Sequence | QDAERLTLPALQQRLSLFPGTHLTPYLSTSPLERDGGAAHSPLLQHMVLLEQPPAQAPLVTGLGALPLHAQSLVGADRVSPSIHKL |
| Gene ID - Mouse | ENSMUSG00000026313 |
| Gene ID - Rat | ENSRNOG00000020372 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti HDAC4 pAb (ATL-HPA071448) | |
| Datasheet | Anti HDAC4 pAb (ATL-HPA071448) Datasheet (External Link) |
| Vendor Page | Anti HDAC4 pAb (ATL-HPA071448) at Atlas Antibodies |
| Documents & Links for Anti HDAC4 pAb (ATL-HPA071448) | |
| Datasheet | Anti HDAC4 pAb (ATL-HPA071448) Datasheet (External Link) |
| Vendor Page | Anti HDAC4 pAb (ATL-HPA071448) |