Anti HDAC4 pAb (ATL-HPA048723)

Atlas Antibodies

Catalog No.:
ATL-HPA048723-25
Shipping:
Calculated at Checkout
$328.00
Adding to cart… The item has been added
Protein Description: histone deacetylase 4
Gene Name: HDAC4
Alternative Gene Name: BDMR, HA6116, HD4, HDAC-4, HDAC-A, HDACA, KIAA0288
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026313: 91%, ENSRNOG00000020372: 93%
Entrez Gene ID: 9759
Uniprot ID: P56524
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen QDAERLTLPALQQRLSLFPGTHLTPYLSTSPLERDGGAAHSPLLQHMVLLEQPPAQAPLVTGLGALPLHAQSLVGADRVSPSIHKL
Gene Sequence QDAERLTLPALQQRLSLFPGTHLTPYLSTSPLERDGGAAHSPLLQHMVLLEQPPAQAPLVTGLGALPLHAQSLVGADRVSPSIHKL
Gene ID - Mouse ENSMUSG00000026313
Gene ID - Rat ENSRNOG00000020372
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti HDAC4 pAb (ATL-HPA048723)
Datasheet Anti HDAC4 pAb (ATL-HPA048723) Datasheet (External Link)
Vendor Page Anti HDAC4 pAb (ATL-HPA048723) at Atlas Antibodies

Documents & Links for Anti HDAC4 pAb (ATL-HPA048723)
Datasheet Anti HDAC4 pAb (ATL-HPA048723) Datasheet (External Link)
Vendor Page Anti HDAC4 pAb (ATL-HPA048723)