Anti HDAC3 pAb (ATL-HPA052052)

Atlas Antibodies

Catalog No.:
ATL-HPA052052-25
Shipping:
Calculated at Checkout
$351.00
Adding to cart… The item has been added
Protein Description: histone deacetylase 3
Gene Name: HDAC3
Alternative Gene Name: HD3, RPD3, RPD3-2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024454: 100%, ENSRNOG00000019618: 100%
Entrez Gene ID: 8841
Uniprot ID: O15379
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC, ChIP-Exo-Seq
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen QYLDQIRQTIFENLKMLNHAPSVQIHDVPADLLTYDRTDEADAEERGPEENYSRPEAPNEFYDGDHDNDKESDVE
Gene Sequence QYLDQIRQTIFENLKMLNHAPSVQIHDVPADLLTYDRTDEADAEERGPEENYSRPEAPNEFYDGDHDNDKESDVE
Gene ID - Mouse ENSMUSG00000024454
Gene ID - Rat ENSRNOG00000019618
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti HDAC3 pAb (ATL-HPA052052)
Datasheet Anti HDAC3 pAb (ATL-HPA052052) Datasheet (External Link)
Vendor Page Anti HDAC3 pAb (ATL-HPA052052) at Atlas Antibodies

Documents & Links for Anti HDAC3 pAb (ATL-HPA052052)
Datasheet Anti HDAC3 pAb (ATL-HPA052052) Datasheet (External Link)
Vendor Page Anti HDAC3 pAb (ATL-HPA052052)