Anti HCFC2 pAb (ATL-HPA006227)

Atlas Antibodies

SKU:
ATL-HPA006227-100
  • Immunohistochemical staining of human Testis shows strong nuclear positivity in spermatids.
  • Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm & cytosol.
  • Western blot analysis in human cell line U-138MG.
Shipping:
Calculated at Checkout
$596.00
Adding to cart… The item has been added
Protein Description: host cell factor C2
Gene Name: HCFC2
Alternative Gene Name: HCF-2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020246: 65%, ENSRNOG00000053510: 60%
Entrez Gene ID: 29915
Uniprot ID: Q9Y5Z7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen APSQVQLIKATTNSFHVKWDEVSTVEGYLLQLSTDLPYQAASSDSSAAPNMQGVRMDPHRQGSNNIVPNSINDTINSTKTEQPATKETSMKNKPDFKALTDSNAILYPSLASNASNHNSHVVDMLRKNEGPHTSANVGV
Gene Sequence APSQVQLIKATTNSFHVKWDEVSTVEGYLLQLSTDLPYQAASSDSSAAPNMQGVRMDPHRQGSNNIVPNSINDTINSTKTEQPATKETSMKNKPDFKALTDSNAILYPSLASNASNHNSHVVDMLRKNEGPHTSANVGV
Gene ID - Mouse ENSMUSG00000020246
Gene ID - Rat ENSRNOG00000053510
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti HCFC2 pAb (ATL-HPA006227)
Datasheet Anti HCFC2 pAb (ATL-HPA006227) Datasheet (External Link)
Vendor Page Anti HCFC2 pAb (ATL-HPA006227) at Atlas Antibodies

Documents & Links for Anti HCFC2 pAb (ATL-HPA006227)
Datasheet Anti HCFC2 pAb (ATL-HPA006227) Datasheet (External Link)
Vendor Page Anti HCFC2 pAb (ATL-HPA006227)