Anti HBZ pAb (ATL-HPA071726)

Atlas Antibodies

Catalog No.:
ATL-HPA071726-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: hemoglobin subunit zeta
Gene Name: HBZ
Alternative Gene Name: HBZ-T1, HBZ1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000055609: 71%, ENSRNOG00000020536: 69%
Entrez Gene ID: 3050
Uniprot ID: P02008
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TIIVSMWAKISTQADTIGTETLERLFLSHPQTKTY
Gene Sequence TIIVSMWAKISTQADTIGTETLERLFLSHPQTKTY
Gene ID - Mouse ENSMUSG00000055609
Gene ID - Rat ENSRNOG00000020536
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti HBZ pAb (ATL-HPA071726)
Datasheet Anti HBZ pAb (ATL-HPA071726) Datasheet (External Link)
Vendor Page Anti HBZ pAb (ATL-HPA071726) at Atlas Antibodies

Documents & Links for Anti HBZ pAb (ATL-HPA071726)
Datasheet Anti HBZ pAb (ATL-HPA071726) Datasheet (External Link)
Vendor Page Anti HBZ pAb (ATL-HPA071726)