Anti HBZ pAb (ATL-HPA071726)
Atlas Antibodies
- Catalog No.:
- ATL-HPA071726-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: HBZ
Alternative Gene Name: HBZ-T1, HBZ1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000055609: 71%, ENSRNOG00000020536: 69%
Entrez Gene ID: 3050
Uniprot ID: P02008
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | TIIVSMWAKISTQADTIGTETLERLFLSHPQTKTY |
Gene Sequence | TIIVSMWAKISTQADTIGTETLERLFLSHPQTKTY |
Gene ID - Mouse | ENSMUSG00000055609 |
Gene ID - Rat | ENSRNOG00000020536 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti HBZ pAb (ATL-HPA071726) | |
Datasheet | Anti HBZ pAb (ATL-HPA071726) Datasheet (External Link) |
Vendor Page | Anti HBZ pAb (ATL-HPA071726) at Atlas Antibodies |
Documents & Links for Anti HBZ pAb (ATL-HPA071726) | |
Datasheet | Anti HBZ pAb (ATL-HPA071726) Datasheet (External Link) |
Vendor Page | Anti HBZ pAb (ATL-HPA071726) |