Anti HBQ1 pAb (ATL-HPA062473 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA062473-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: hemoglobin, theta 1
Gene Name: HBQ1
Alternative Gene Name: HBQ
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000073063: 81%, ENSRNOG00000029886: 61%
Entrez Gene ID: 3049
Uniprot ID: P09105
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RHYPGDFSPALQASLDKFLSHVISALVSEYR
Gene Sequence RHYPGDFSPALQASLDKFLSHVISALVSEYR
Gene ID - Mouse ENSMUSG00000073063
Gene ID - Rat ENSRNOG00000029886
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti HBQ1 pAb (ATL-HPA062473 w/enhanced validation)
Datasheet Anti HBQ1 pAb (ATL-HPA062473 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti HBQ1 pAb (ATL-HPA062473 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti HBQ1 pAb (ATL-HPA062473 w/enhanced validation)
Datasheet Anti HBQ1 pAb (ATL-HPA062473 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti HBQ1 pAb (ATL-HPA062473 w/enhanced validation)