Anti HBQ1 pAb (ATL-HPA062473 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA062473-25

Protein Description: hemoglobin, theta 1
Gene Name: HBQ1
Alternative Gene Name: HBQ
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000073063: 81%, ENSRNOG00000029886: 61%
Entrez Gene ID: 3049
Uniprot ID: P09105
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RHYPGDFSPALQASLDKFLSHVISALVSEYR
• Gene Sequence: RHYPGDFSPALQASLDKFLSHVISALVSEYR
• Gene ID - Mouse: ENSMUSG00000073063
• Gene ID - Rat: ENSRNOG00000029886
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.