Anti HAX1 pAb (ATL-HPA075289)

Atlas Antibodies

Catalog No.: ATL-HPA075289-100

Protein Description: HCLS1 associated protein X-1
Gene Name: HAX1
Alternative Gene Name: HCLSBP1, HS1BP1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027944: 90%, ENSRNOG00000016589: 30%
Entrez Gene ID: 10456
Uniprot ID: O00165
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LGPVLQPQPKSYFKSISVTKITKPDGIVEERRTVVDSEGRTETTVTRHEA
• Gene Sequence: LGPVLQPQPKSYFKSISVTKITKPDGIVEERRTVVDSEGRTETTVTRHEA
• Gene ID - Mouse: ENSMUSG00000027944
• Gene ID - Rat: ENSRNOG00000016589
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.