Anti HAUS5 pAb (ATL-HPA067250)

Atlas Antibodies

Catalog No.: ATL-HPA067250-25

Protein Description: HAUS augmin-like complex, subunit 5
Gene Name: HAUS5
Alternative Gene Name: dgt5, KIAA0841
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000078762: 71%, ENSRNOG00000024266: 70%
Entrez Gene ID: 23354
Uniprot ID: O94927
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ARQHTQDTQRRALLLRAQAGAMRRQQHTLRDPMQRLQNQLRRLQDMERKAKVDVTFGSLTSAALGLEPVVLRDVRTACTLRAQFLQNLLLPQAKRGSLPTPHDDHFGTSYQ
• Gene Sequence: ARQHTQDTQRRALLLRAQAGAMRRQQHTLRDPMQRLQNQLRRLQDMERKAKVDVTFGSLTSAALGLEPVVLRDVRTACTLRAQFLQNLLLPQAKRGSLPTPHDDHFGTSYQ
• Gene ID - Mouse: ENSMUSG00000078762
• Gene ID - Rat: ENSRNOG00000024266
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.