Anti HAUS5 pAb (ATL-HPA067250)

Atlas Antibodies

Catalog No.:
ATL-HPA067250-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: HAUS augmin-like complex, subunit 5
Gene Name: HAUS5
Alternative Gene Name: dgt5, KIAA0841
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000078762: 71%, ENSRNOG00000024266: 70%
Entrez Gene ID: 23354
Uniprot ID: O94927
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ARQHTQDTQRRALLLRAQAGAMRRQQHTLRDPMQRLQNQLRRLQDMERKAKVDVTFGSLTSAALGLEPVVLRDVRTACTLRAQFLQNLLLPQAKRGSLPTPHDDHFGTSYQ
Gene Sequence ARQHTQDTQRRALLLRAQAGAMRRQQHTLRDPMQRLQNQLRRLQDMERKAKVDVTFGSLTSAALGLEPVVLRDVRTACTLRAQFLQNLLLPQAKRGSLPTPHDDHFGTSYQ
Gene ID - Mouse ENSMUSG00000078762
Gene ID - Rat ENSRNOG00000024266
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti HAUS5 pAb (ATL-HPA067250)
Datasheet Anti HAUS5 pAb (ATL-HPA067250) Datasheet (External Link)
Vendor Page Anti HAUS5 pAb (ATL-HPA067250) at Atlas Antibodies

Documents & Links for Anti HAUS5 pAb (ATL-HPA067250)
Datasheet Anti HAUS5 pAb (ATL-HPA067250) Datasheet (External Link)
Vendor Page Anti HAUS5 pAb (ATL-HPA067250)