Anti HAUS4 pAb (ATL-HPA029803)

Atlas Antibodies

SKU:
ATL-HPA029803-100
  • Immunohistochemical staining of human stomach shows strong membranous positivity in glandular cells.
  • Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp<br/>Lane 4: Human plasma (IgG/HSA depleted)<br/>Lane 5: Human liver tissue<br/>Lane 6: Human tonsil tissue
Shipping:
Calculated at Checkout
$596.00
Adding to cart… The item has been added
Protein Description: HAUS augmin-like complex, subunit 4
Gene Name: HAUS4
Alternative Gene Name: C14orf94, FLJ20424
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022177: 77%, ENSRNOG00000039284: 83%
Entrez Gene ID: 54930
Uniprot ID: Q9H6D7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RCLTLLQRLLQEHRLKTQSELDRINAQYLEVKCGAMILKLRMEELKILSDTYTVEKVEVHRLIRDRLEGAIHLQEQDMENSRQVLNSYEVLGEEFDRLVKEYTVLKQATENKRWALQEFSKVYR
Gene Sequence RCLTLLQRLLQEHRLKTQSELDRINAQYLEVKCGAMILKLRMEELKILSDTYTVEKVEVHRLIRDRLEGAIHLQEQDMENSRQVLNSYEVLGEEFDRLVKEYTVLKQATENKRWALQEFSKVYR
Gene ID - Mouse ENSMUSG00000022177
Gene ID - Rat ENSRNOG00000039284
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti HAUS4 pAb (ATL-HPA029803)
Datasheet Anti HAUS4 pAb (ATL-HPA029803) Datasheet (External Link)
Vendor Page Anti HAUS4 pAb (ATL-HPA029803) at Atlas Antibodies

Documents & Links for Anti HAUS4 pAb (ATL-HPA029803)
Datasheet Anti HAUS4 pAb (ATL-HPA029803) Datasheet (External Link)
Vendor Page Anti HAUS4 pAb (ATL-HPA029803)