Anti HAS3 pAb (ATL-HPA031554)

Atlas Antibodies

Catalog No.:
ATL-HPA031554-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: hyaluronan synthase 3
Gene Name: HAS3
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031910: 93%, ENSRNOG00000059362: 95%
Entrez Gene ID: 3038
Uniprot ID: O00219
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RQEDAYMLDIFHEVLGGTEQAGFFVWRSNFHEAGEGETEASLQEGMDRVRDVVRASTFSC
Gene Sequence RQEDAYMLDIFHEVLGGTEQAGFFVWRSNFHEAGEGETEASLQEGMDRVRDVVRASTFSC
Gene ID - Mouse ENSMUSG00000031910
Gene ID - Rat ENSRNOG00000059362
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti HAS3 pAb (ATL-HPA031554)
Datasheet Anti HAS3 pAb (ATL-HPA031554) Datasheet (External Link)
Vendor Page Anti HAS3 pAb (ATL-HPA031554) at Atlas Antibodies

Documents & Links for Anti HAS3 pAb (ATL-HPA031554)
Datasheet Anti HAS3 pAb (ATL-HPA031554) Datasheet (External Link)
Vendor Page Anti HAS3 pAb (ATL-HPA031554)