Anti HARS pAb (ATL-HPA036539 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA036539-25

• 
• 
• 

Protein Description: histidyl-tRNA synthetase
Gene Name: HARS
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000001380: 86%, ENSRNOG00000028105: 86%
Entrez Gene ID: 3035
Uniprot ID: P12081
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MAERAALEELVKLQGERVRGLKQQKASAELIEEEVAKLLKLKAQLGPDESKQKFVLKTPKGTRD
• Gene Sequence: MAERAALEELVKLQGERVRGLKQQKASAELIEEEVAKLLKLKAQLGPDESKQKFVLKTPKGTRD
• Gene ID - Mouse: ENSMUSG00000001380
• Gene ID - Rat: ENSRNOG00000028105
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.