Anti HAPLN4 pAb (ATL-HPA055856)

Atlas Antibodies

Catalog No.:
ATL-HPA055856-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: hyaluronan and proteoglycan link protein 4
Gene Name: HAPLN4
Alternative Gene Name: BRAL2, KIAA1926
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000007594: 79%, ENSRNOG00000049949: 75%
Entrez Gene ID: 404037
Uniprot ID: Q86UW8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DGSVQYPVNRPREPCGGLGGTGSAGGGGDANGGLRNYGYRHNAEERYDAFCF
Gene Sequence DGSVQYPVNRPREPCGGLGGTGSAGGGGDANGGLRNYGYRHNAEERYDAFCF
Gene ID - Mouse ENSMUSG00000007594
Gene ID - Rat ENSRNOG00000049949
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti HAPLN4 pAb (ATL-HPA055856)
Datasheet Anti HAPLN4 pAb (ATL-HPA055856) Datasheet (External Link)
Vendor Page Anti HAPLN4 pAb (ATL-HPA055856) at Atlas Antibodies

Documents & Links for Anti HAPLN4 pAb (ATL-HPA055856)
Datasheet Anti HAPLN4 pAb (ATL-HPA055856) Datasheet (External Link)
Vendor Page Anti HAPLN4 pAb (ATL-HPA055856)