Anti HAPLN2 pAb (ATL-HPA045765 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA045765-100
Shipping:
Calculated at Checkout
$596.00
Adding to cart… The item has been added
Protein Description: hyaluronan and proteoglycan link protein 2
Gene Name: HAPLN2
Alternative Gene Name: BRAL1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000004894: 94%, ENSRNOG00000018870: 94%
Entrez Gene ID: 60484
Uniprot ID: Q9GZV7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DPASHPGPHYLLPPIHEVIHSHRGATATLPCVLGTTPPSYKVRWSKVEPGELRETLILITNGLH
Gene Sequence DPASHPGPHYLLPPIHEVIHSHRGATATLPCVLGTTPPSYKVRWSKVEPGELRETLILITNGLH
Gene ID - Mouse ENSMUSG00000004894
Gene ID - Rat ENSRNOG00000018870
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti HAPLN2 pAb (ATL-HPA045765 w/enhanced validation)
Datasheet Anti HAPLN2 pAb (ATL-HPA045765 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti HAPLN2 pAb (ATL-HPA045765 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti HAPLN2 pAb (ATL-HPA045765 w/enhanced validation)
Datasheet Anti HAPLN2 pAb (ATL-HPA045765 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti HAPLN2 pAb (ATL-HPA045765 w/enhanced validation)