Anti HAO1 pAb (ATL-HPA072442 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA072442-100

• 
• 

Protein Description: hydroxyacid oxidase 1
Gene Name: HAO1
Alternative Gene Name: GOX, GOX1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027261: 86%, ENSRNOG00000004601: 88%
Entrez Gene ID: 54363
Uniprot ID: Q9UJM8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LGTGMMLSSWATSSIEEVAEAGPEALRWLQLYIYKDREVTKKLVRQAEKMGYKAIFVTVDTPYLGNRLDDVRNRFKLP
• Gene Sequence: LGTGMMLSSWATSSIEEVAEAGPEALRWLQLYIYKDREVTKKLVRQAEKMGYKAIFVTVDTPYLGNRLDDVRNRFKLP
• Gene ID - Mouse: ENSMUSG00000027261
• Gene ID - Rat: ENSRNOG00000004601
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.