Anti HAO1 pAb (ATL-HPA049552 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA049552-25
  • Immunohistochemistry analysis in human liver and endometrium tissues using HPA049552 antibody. Corresponding HAO1 RNA-seq data are presented for the same tissues.
  • Western blot analysis in human liver tissue.
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: hydroxyacid oxidase (glycolate oxidase) 1
Gene Name: HAO1
Alternative Gene Name: GOX, GOX1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027261: 89%, ENSRNOG00000004601: 88%
Entrez Gene ID: 54363
Uniprot ID: Q9UJM8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen QHAKSVLPKSIYDYYRSGANDEETLADNIAAFSRWKLYPRMLRNVAETDLSTSVLGQRVSMPICVGATAMQRMAHVDGELATVR
Gene Sequence QHAKSVLPKSIYDYYRSGANDEETLADNIAAFSRWKLYPRMLRNVAETDLSTSVLGQRVSMPICVGATAMQRMAHVDGELATVR
Gene ID - Mouse ENSMUSG00000027261
Gene ID - Rat ENSRNOG00000004601
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti HAO1 pAb (ATL-HPA049552 w/enhanced validation)
Datasheet Anti HAO1 pAb (ATL-HPA049552 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti HAO1 pAb (ATL-HPA049552 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti HAO1 pAb (ATL-HPA049552 w/enhanced validation)
Datasheet Anti HAO1 pAb (ATL-HPA049552 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti HAO1 pAb (ATL-HPA049552 w/enhanced validation)



Citations for Anti HAO1 pAb (ATL-HPA049552 w/enhanced validation) – 1 Found
Kampf, Caroline; Mardinoglu, Adil; Fagerberg, Linn; Hallström, Björn M; Edlund, Karolina; Lundberg, Emma; Pontén, Fredrik; Nielsen, Jens; Uhlen, Mathias. The human liver-specific proteome defined by transcriptomics and antibody-based profiling. Faseb Journal : Official Publication Of The Federation Of American Societies For Experimental Biology. 2014;28(7):2901-14.  PubMed