Anti HAL pAb (ATL-HPA038547 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA038547-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: histidine ammonia-lyase
Gene Name: HAL
Alternative Gene Name: HIS
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020017: 90%, ENSRNOG00000004502: 89%
Entrez Gene ID: 3034
Uniprot ID: P42357
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen FVEVVIEGDAMSPDFIPSQPEGVYLYSKYREPEKYIELDGDRLTTEDLVNLGKGRYKIKLTPTAEKRVQKSREVIDSIIKEKTVVYGITTGFGKFARTV
Gene Sequence FVEVVIEGDAMSPDFIPSQPEGVYLYSKYREPEKYIELDGDRLTTEDLVNLGKGRYKIKLTPTAEKRVQKSREVIDSIIKEKTVVYGITTGFGKFARTV
Gene ID - Mouse ENSMUSG00000020017
Gene ID - Rat ENSRNOG00000004502
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti HAL pAb (ATL-HPA038547 w/enhanced validation)
Datasheet Anti HAL pAb (ATL-HPA038547 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti HAL pAb (ATL-HPA038547 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti HAL pAb (ATL-HPA038547 w/enhanced validation)
Datasheet Anti HAL pAb (ATL-HPA038547 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti HAL pAb (ATL-HPA038547 w/enhanced validation)
Citations for Anti HAL pAb (ATL-HPA038547 w/enhanced validation) – 1 Found
Cabanes-Creus, Marti; Navarro, Renina Gale; Liao, Sophia H Y; Scott, Suzanne; Carlessi, Rodrigo; Roca-Pinilla, Ramon; Knight, Maddison; Baltazar, Grober; Zhu, Erhua; Jones, Matthew; Denisenko, Elena; Forrest, Alistair R R; Alexander, Ian E; Tirnitz-Parker, Janina E E; Lisowski, Leszek. Characterization of the humanized FRG mouse model and development of an AAV-LK03 variant with improved liver lobular biodistribution. Molecular Therapy. Methods & Clinical Development. 2023;28( 36700121):220-237.  PubMed