Anti HAL pAb (ATL-HPA038547 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA038547-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: HAL
Alternative Gene Name: HIS
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020017: 90%, ENSRNOG00000004502: 89%
Entrez Gene ID: 3034
Uniprot ID: P42357
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | FVEVVIEGDAMSPDFIPSQPEGVYLYSKYREPEKYIELDGDRLTTEDLVNLGKGRYKIKLTPTAEKRVQKSREVIDSIIKEKTVVYGITTGFGKFARTV |
| Gene Sequence | FVEVVIEGDAMSPDFIPSQPEGVYLYSKYREPEKYIELDGDRLTTEDLVNLGKGRYKIKLTPTAEKRVQKSREVIDSIIKEKTVVYGITTGFGKFARTV |
| Gene ID - Mouse | ENSMUSG00000020017 |
| Gene ID - Rat | ENSRNOG00000004502 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti HAL pAb (ATL-HPA038547 w/enhanced validation) | |
| Datasheet | Anti HAL pAb (ATL-HPA038547 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti HAL pAb (ATL-HPA038547 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti HAL pAb (ATL-HPA038547 w/enhanced validation) | |
| Datasheet | Anti HAL pAb (ATL-HPA038547 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti HAL pAb (ATL-HPA038547 w/enhanced validation) |
| Citations for Anti HAL pAb (ATL-HPA038547 w/enhanced validation) – 1 Found |
| Cabanes-Creus, Marti; Navarro, Renina Gale; Liao, Sophia H Y; Scott, Suzanne; Carlessi, Rodrigo; Roca-Pinilla, Ramon; Knight, Maddison; Baltazar, Grober; Zhu, Erhua; Jones, Matthew; Denisenko, Elena; Forrest, Alistair R R; Alexander, Ian E; Tirnitz-Parker, Janina E E; Lisowski, Leszek. Characterization of the humanized FRG mouse model and development of an AAV-LK03 variant with improved liver lobular biodistribution. Molecular Therapy. Methods & Clinical Development. 2023;28( 36700121):220-237. PubMed |