Anti HAGH pAb (ATL-HPA061143)

Atlas Antibodies

Catalog No.:
ATL-HPA061143-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: hydroxyacylglutathione hydrolase
Gene Name: HAGH
Alternative Gene Name: GLO2, GLXII, HAGH1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024158: 93%, ENSRNOG00000014743: 89%
Entrez Gene ID: 3029
Uniprot ID: Q16775
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen CGKFYEGTADEMCKALLEVLGRLPPDTRVYCGHEYTINNLKFARHVEPGNAAIREKL
Gene Sequence CGKFYEGTADEMCKALLEVLGRLPPDTRVYCGHEYTINNLKFARHVEPGNAAIREKL
Gene ID - Mouse ENSMUSG00000024158
Gene ID - Rat ENSRNOG00000014743
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti HAGH pAb (ATL-HPA061143)
Datasheet Anti HAGH pAb (ATL-HPA061143) Datasheet (External Link)
Vendor Page Anti HAGH pAb (ATL-HPA061143) at Atlas Antibodies

Documents & Links for Anti HAGH pAb (ATL-HPA061143)
Datasheet Anti HAGH pAb (ATL-HPA061143) Datasheet (External Link)
Vendor Page Anti HAGH pAb (ATL-HPA061143)