Anti HABP4 pAb (ATL-HPA062366)

Atlas Antibodies

Catalog No.:
ATL-HPA062366-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: hyaluronan binding protein 4
Gene Name: HABP4
Alternative Gene Name: IHABP4, SERBP1L
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021476: 94%, ENSRNOG00000019027: 94%
Entrez Gene ID: 22927
Uniprot ID: Q5JVS0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LEVEEETQVQEMTLDEWKNLQEQTRPKPEFNIRKPESTVPSKAVVIHKSKYRDDMVKDDYEDDSHVFR
Gene Sequence LEVEEETQVQEMTLDEWKNLQEQTRPKPEFNIRKPESTVPSKAVVIHKSKYRDDMVKDDYEDDSHVFR
Gene ID - Mouse ENSMUSG00000021476
Gene ID - Rat ENSRNOG00000019027
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti HABP4 pAb (ATL-HPA062366)
Datasheet Anti HABP4 pAb (ATL-HPA062366) Datasheet (External Link)
Vendor Page Anti HABP4 pAb (ATL-HPA062366) at Atlas Antibodies

Documents & Links for Anti HABP4 pAb (ATL-HPA062366)
Datasheet Anti HABP4 pAb (ATL-HPA062366) Datasheet (External Link)
Vendor Page Anti HABP4 pAb (ATL-HPA062366)