Anti HABP4 pAb (ATL-HPA055969 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA055969-25

Protein Description: hyaluronan binding protein 4
Gene Name: HABP4
Alternative Gene Name: IHABP4, SERBP1L
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021476: 72%, ENSRNOG00000019027: 75%
Entrez Gene ID: 22927
Uniprot ID: Q5JVS0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RGGPGNRVFDAFDQRGKREFERYGGNDKIAVRTEDNMGGCGVRTWGSGKDTSDVEPTAPMEEPTVVEESQGTPEEESPAKVPE
• Gene Sequence: RGGPGNRVFDAFDQRGKREFERYGGNDKIAVRTEDNMGGCGVRTWGSGKDTSDVEPTAPMEEPTVVEESQGTPEEESPAKVPE
• Gene ID - Mouse: ENSMUSG00000021476
• Gene ID - Rat: ENSRNOG00000019027
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti HABP4 pAb (ATL-HPA055969 w/enhanced validation) – 2 Found

Chen, Haiqi; Murray, Evan; Sinha, Anubhav; Laumas, Anisha; Li, Jilong; Lesman, Daniel; Nie, Xichen; Hotaling, Jim; Guo, Jingtao; Cairns, Bradley R; Macosko, Evan Z; Cheng, C Yan; Chen, Fei. Dissecting mammalian spermatogenesis using spatial transcriptomics. Cell Reports. 2021;37(5):109915. 

Melo-Hanchuk, Talita Diniz; Colleti, Carolina; Saito, Ângela; Mendes, Maria Carolina Santos; Carvalheira, José Barreto Campello; Vassallo, Jose; Kobarg, Jörg. Intracellular hyaluronic acid-binding protein 4 (HABP4): a candidate tumor suppressor in colorectal cancer. Oncotarget. 2020;11(46):4325-4337.