Anti H6PD pAb (ATL-HPA005440)

Atlas Antibodies

SKU:
ATL-HPA005440-25
  • Immunohistochemical staining of human liver shows moderate cytoplasmic positivity in hepatocytes.
  • Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells)<br/>Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: hexose-6-phosphate dehydrogenase (glucose 1-dehydrogenase)
Gene Name: H6PD
Alternative Gene Name: GDH
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028980: 85%, ENSRNOG00000017523: 86%
Entrez Gene ID: 9563
Uniprot ID: O95479
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human, Mouse
Clonality Polyclonal
Host Rabbit
Immunogen APMPSDFQVLRAKYRESPLVSAWSEELISKLANDIEATAVRAVRRFGQFHLALSGGSSPVALFQQLATAHYGFPWAHTHLWLVDERCVPLSDPESNFQGLQAHLLQHVRIPYYNIHP
Gene Sequence APMPSDFQVLRAKYRESPLVSAWSEELISKLANDIEATAVRAVRRFGQFHLALSGGSSPVALFQQLATAHYGFPWAHTHLWLVDERCVPLSDPESNFQGLQAHLLQHVRIPYYNIHP
Gene ID - Mouse ENSMUSG00000028980
Gene ID - Rat ENSRNOG00000017523
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti H6PD pAb (ATL-HPA005440)
Datasheet Anti H6PD pAb (ATL-HPA005440) Datasheet (External Link)
Vendor Page Anti H6PD pAb (ATL-HPA005440) at Atlas Antibodies

Documents & Links for Anti H6PD pAb (ATL-HPA005440)
Datasheet Anti H6PD pAb (ATL-HPA005440) Datasheet (External Link)
Vendor Page Anti H6PD pAb (ATL-HPA005440)