Anti H6PD pAb (ATL-HPA004824)

Atlas Antibodies

SKU: ATL-HPA004824-25

• 
• 

Protein Description: hexose-6-phosphate dehydrogenase (glucose 1-dehydrogenase)
Gene Name: H6PD
Alternative Gene Name: GDH
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028980: 83%, ENSRNOG00000017523: 83%
Entrez Gene ID: 9563
Uniprot ID: O95479
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: WQGLFQLYLDEAGRGHSFSFHGAALTAPKQGQELMAKALESLSCPKDMAPSHCAEHKDQFLQLSQYRQLKTAEDYQALNKDIEAQLQHAGLREAGRIFYFSVPPFAYEDIAR
• Gene Sequence: WQGLFQLYLDEAGRGHSFSFHGAALTAPKQGQELMAKALESLSCPKDMAPSHCAEHKDQFLQLSQYRQLKTAEDYQALNKDIEAQLQHAGLREAGRIFYFSVPPFAYEDIAR
• Gene ID - Mouse: ENSMUSG00000028980
• Gene ID - Rat: ENSRNOG00000017523
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti H6PD pAb (ATL-HPA004824) – 3 Found

Tsachaki, Maria; Mladenovic, Natasa; Štambergová, Hana; Birk, Julia; Odermatt, Alex. Hexose-6-phosphate dehydrogenase controls cancer cell proliferation and migration through pleiotropic effects on the unfolded-protein response, calcium homeostasis, and redox balance. Faseb Journal : Official Publication Of The Federation Of American Societies For Experimental Biology. 2018;32(5):2690-2705. 

Weingartner, Michael; Stücheli, Simon; Jebbawi, Fadi; Gottstein, Bruno; Beldi, Guido; Lundström-Stadelmann, Britta; Wang, Junhua; Odermatt, Alex. Albendazole reduces hepatic inflammation and endoplasmic reticulum-stress in a mouse model of chronic Echinococcus multilocularis infection. Plos Neglected Tropical Diseases. 2022;16(1):e0009192. 

Kato, Bernet S; Nicholson, George; Neiman, Maja; Rantalainen, Mattias; Holmes, Chris C; Barrett, Amy; Uhlén, Mathias; Nilsson, Peter; Spector, Tim D; Schwenk, Jochen M. Variance decomposition of protein profiles from antibody arrays using a longitudinal twin model. Proteome Science. 2011;9( 22093360):73.