Anti H2BFWT pAb (ATL-HPA056289)

Atlas Antibodies

Catalog No.:
ATL-HPA056289-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: H2B histone family, member W, testis-specific
Gene Name: H2BFWT
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027829: 34%, ENSRNOG00000053285: 39%
Entrez Gene ID: 158983
Uniprot ID: Q7Z2G1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PKEANSTTSQKQSKQRKRGRHGPRRCHSNCRGDSFATYFRRVL
Gene Sequence PKEANSTTSQKQSKQRKRGRHGPRRCHSNCRGDSFATYFRRVL
Gene ID - Mouse ENSMUSG00000027829
Gene ID - Rat ENSRNOG00000053285
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti H2BFWT pAb (ATL-HPA056289)
Datasheet Anti H2BFWT pAb (ATL-HPA056289) Datasheet (External Link)
Vendor Page Anti H2BFWT pAb (ATL-HPA056289) at Atlas Antibodies

Documents & Links for Anti H2BFWT pAb (ATL-HPA056289)
Datasheet Anti H2BFWT pAb (ATL-HPA056289) Datasheet (External Link)
Vendor Page Anti H2BFWT pAb (ATL-HPA056289)