Anti H2AFY2 pAb (ATL-HPA035865 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA035865-25

• 
• 

Protein Description: H2A histone family, member Y2
Gene Name: H2AFY2
Alternative Gene Name: macroH2A2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020086: 99%, ENSRNOG00000024751: 99%
Entrez Gene ID: 55506
Uniprot ID: Q9P0M6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ILSSKSLVLGQKLSLTQSDISHIGSMRVEGIVHPTTAEIDLKEDIGKALEKAGGKEFLETVKELRKSQGPL
• Gene Sequence: ILSSKSLVLGQKLSLTQSDISHIGSMRVEGIVHPTTAEIDLKEDIGKALEKAGGKEFLETVKELRKSQGPL
• Gene ID - Mouse: ENSMUSG00000020086
• Gene ID - Rat: ENSRNOG00000024751
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti H2AFY2 pAb (ATL-HPA035865 w/enhanced validation) – 1 Found

Kelliher, Jessica L; West, Kirk L; Gong, Qingguo; Leung, Justin W C. Histone H2A variants alpha1-extension helix directs RNF168-mediated ubiquitination. Nature Communications. 2020;11(1):2462.