Anti H2AFY pAb (ATL-HPA050962)
Atlas Antibodies
- Catalog No.:
- ATL-HPA050962-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: H2AFY
Alternative Gene Name: macroH2A1.2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000015937: 96%, ENSRNOG00000011523: 93%
Entrez Gene ID: 9555
Uniprot ID: O75367
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | GKLEAIITPPPAKKAKSPSQKKPVSKKAGGKKGARKSKKKQGEVSKAASADSTTEGTPADGFTVLSTK |
Gene Sequence | GKLEAIITPPPAKKAKSPSQKKPVSKKAGGKKGARKSKKKQGEVSKAASADSTTEGTPADGFTVLSTK |
Gene ID - Mouse | ENSMUSG00000015937 |
Gene ID - Rat | ENSRNOG00000011523 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti H2AFY pAb (ATL-HPA050962) | |
Datasheet | Anti H2AFY pAb (ATL-HPA050962) Datasheet (External Link) |
Vendor Page | Anti H2AFY pAb (ATL-HPA050962) at Atlas Antibodies |
Documents & Links for Anti H2AFY pAb (ATL-HPA050962) | |
Datasheet | Anti H2AFY pAb (ATL-HPA050962) Datasheet (External Link) |
Vendor Page | Anti H2AFY pAb (ATL-HPA050962) |