Anti H2AFY pAb (ATL-HPA050962)

Atlas Antibodies

Catalog No.:
ATL-HPA050962-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: H2A histone family, member Y
Gene Name: H2AFY
Alternative Gene Name: macroH2A1.2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000015937: 96%, ENSRNOG00000011523: 93%
Entrez Gene ID: 9555
Uniprot ID: O75367
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GKLEAIITPPPAKKAKSPSQKKPVSKKAGGKKGARKSKKKQGEVSKAASADSTTEGTPADGFTVLSTK
Gene Sequence GKLEAIITPPPAKKAKSPSQKKPVSKKAGGKKGARKSKKKQGEVSKAASADSTTEGTPADGFTVLSTK
Gene ID - Mouse ENSMUSG00000015937
Gene ID - Rat ENSRNOG00000011523
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti H2AFY pAb (ATL-HPA050962)
Datasheet Anti H2AFY pAb (ATL-HPA050962) Datasheet (External Link)
Vendor Page Anti H2AFY pAb (ATL-HPA050962) at Atlas Antibodies

Documents & Links for Anti H2AFY pAb (ATL-HPA050962)
Datasheet Anti H2AFY pAb (ATL-HPA050962) Datasheet (External Link)
Vendor Page Anti H2AFY pAb (ATL-HPA050962)