Anti GZMM pAb (ATL-HPA015624 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA015624-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: GZMM
Alternative Gene Name: LMET1, MET1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000054206: 81%, ENSRNOG00000030530: 78%
Entrez Gene ID: 3004
Uniprot ID: P51124
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | PSMVCLAADSKDQAPCKGDSGGPLVCGKGRVLAGVLSFSSRVCTDIFKPPVATAVAPYVSWIRKVTGR |
| Gene Sequence | PSMVCLAADSKDQAPCKGDSGGPLVCGKGRVLAGVLSFSSRVCTDIFKPPVATAVAPYVSWIRKVTGR |
| Gene ID - Mouse | ENSMUSG00000054206 |
| Gene ID - Rat | ENSRNOG00000030530 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti GZMM pAb (ATL-HPA015624 w/enhanced validation) | |
| Datasheet | Anti GZMM pAb (ATL-HPA015624 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti GZMM pAb (ATL-HPA015624 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti GZMM pAb (ATL-HPA015624 w/enhanced validation) | |
| Datasheet | Anti GZMM pAb (ATL-HPA015624 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti GZMM pAb (ATL-HPA015624 w/enhanced validation) |
| Citations for Anti GZMM pAb (ATL-HPA015624 w/enhanced validation) – 1 Found |
| Lee, Soo Jung; Kondepudi, Akhil; Young, Kelly Z; Zhang, Xiaojie; Cartee, Naw May Pearl; Chen, Jijun; Jang, Krystal Yujin; Xu, Gang; Borjigin, Jimo; Wang, Michael M. Concentration of non-myocyte proteins in arterial media of cerebral autosomal dominant arteriopathy with subcortical infarcts and leukoencephalopathy. Plos One. 18(2):e0281094. PubMed |