Anti GZMB pAb (ATL-HPA003418 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA003418-25

• 
• 

Protein Description: granzyme B (granzyme 2, cytotoxic T-lymphocyte-associated serine esterase 1)
Gene Name: GZMB
Alternative Gene Name: CCPI, CGL-1, CGL1, CSP-B, CSPB, CTLA1, CTSGL1, HLP, SECT
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000015437: 63%, ENSRNOG00000045973: 63%
Entrez Gene ID: 3002
Uniprot ID: P10144
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: TRAVQPLRLPSNKAQVKPGQTCSVAGWGQTAPLGKHSHTLQEVKMTVQEDRKCESDLRHYYDSTIELCVGDPEIKKTSFKGDSGGPLVCNKVAQGIVSYGRNNGMPPRACTKVSS
• Gene Sequence: TRAVQPLRLPSNKAQVKPGQTCSVAGWGQTAPLGKHSHTLQEVKMTVQEDRKCESDLRHYYDSTIELCVGDPEIKKTSFKGDSGGPLVCNKVAQGIVSYGRNNGMPPRACTKVSS
• Gene ID - Mouse: ENSMUSG00000015437
• Gene ID - Rat: ENSRNOG00000045973
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti GZMB pAb (ATL-HPA003418 w/enhanced validation) – 3 Found

Wang, Xin; Li, Wen-Sheng; Zheng, Yan; Ying, Zhao-Xia; Wang, Yong-Xian; Wang, Ying-Mei; Zheng, Jun-Feng; Xiao, Sheng-Xiang. The progression of CD56(+) myeloid sarcoma: A case report and literature review. Oncology Letters. 2016;11(5):3091-3096. 

Deleage, Claire; Immonen, Taina T; Fennessey, Christine M; Reynaldi, Arnold; Reid, Carolyn; Newman, Laura; Lipkey, Leslie; Schlub, Timothy E; Camus, Celine; O'Brien, Sean; Smedley, Jeremy; Conway, Jessica M; Del Prete, Gregory Q; Davenport, Miles P; Lifson, Jeffrey D; Estes, Jacob D; Keele, Brandon F. Defining early SIV replication and dissemination dynamics following vaginal transmission. Science Advances. 2019;5(5):eaav7116. 

Pino, Maria; Paganini, Sara; Deleage, Claire; Padhan, Kartika; Harper, Justin L; King, Colin T; Micci, Luca; Cervasi, Barbara; Mudd, Joseph C; Gill, Kiran P; Jean, Sherrie M; Easley, Kirk; Silvestri, Guido; Estes, Jacob D; Petrovas, Constantinos; Lederman, Michael M; Paiardini, Mirko. Fingolimod retains cytolytic T cells and limits T follicular helper cell infection in lymphoid sites of SIV persistence. Plos Pathogens. 2019;15(10):e1008081.