Anti GYPC pAb (ATL-HPA008965 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA008965-100
  • Immunohistochemistry analysis in human bone marrow and pancreas tissues using HPA008965 antibody. Corresponding GYPC RNA-seq data are presented for the same tissues.
  • Western blot analysis in control (vector only transfected HEK293T lysate) and GYPC over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY419537).
Shipping:
Calculated at Checkout
$596.00
Adding to cart… The item has been added
Protein Description: glycophorin C (Gerbich blood group)
Gene Name: GYPC
Alternative Gene Name: CD236, CD236R, Ge, GPC, GYPD
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000090523: 91%, ENSRNOG00000029939: 89%
Entrez Gene ID: 2995
Uniprot ID: P04921
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RYMYRHKGTYHTNEAKGTEFAESADAALQGDPALQDAGDSSRKEYFI
Gene Sequence RYMYRHKGTYHTNEAKGTEFAESADAALQGDPALQDAGDSSRKEYFI
Gene ID - Mouse ENSMUSG00000090523
Gene ID - Rat ENSRNOG00000029939
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti GYPC pAb (ATL-HPA008965 w/enhanced validation)
Datasheet Anti GYPC pAb (ATL-HPA008965 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti GYPC pAb (ATL-HPA008965 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti GYPC pAb (ATL-HPA008965 w/enhanced validation)
Datasheet Anti GYPC pAb (ATL-HPA008965 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti GYPC pAb (ATL-HPA008965 w/enhanced validation)