Anti GYG1 pAb (ATL-HPA073229)

Atlas Antibodies

Catalog No.:
ATL-HPA073229-100
Shipping:
Calculated at Checkout
$638.00
Adding to cart… The item has been added
Protein Description: glycogenin 1
Gene Name: GYG1
Alternative Gene Name: GYG
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000019528: 97%, ENSRNOG00000011146: 100%
Entrez Gene ID: 2992
Uniprot ID: P46976
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PQVSDSMRKVLETVFDEVIMVDVLDSGDSAHLTLMKRP
Gene Sequence PQVSDSMRKVLETVFDEVIMVDVLDSGDSAHLTLMKRP
Gene ID - Mouse ENSMUSG00000019528
Gene ID - Rat ENSRNOG00000011146
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti GYG1 pAb (ATL-HPA073229)
Datasheet Anti GYG1 pAb (ATL-HPA073229) Datasheet (External Link)
Vendor Page Anti GYG1 pAb (ATL-HPA073229) at Atlas Antibodies

Documents & Links for Anti GYG1 pAb (ATL-HPA073229)
Datasheet Anti GYG1 pAb (ATL-HPA073229) Datasheet (External Link)
Vendor Page Anti GYG1 pAb (ATL-HPA073229)