Anti GYG1 pAb (ATL-HPA073229)
Atlas Antibodies
- Catalog No.:
- ATL-HPA073229-100
- Shipping:
- Calculated at Checkout
$596.00
Gene Name: GYG1
Alternative Gene Name: GYG
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000019528: 97%, ENSRNOG00000011146: 100%
Entrez Gene ID: 2992
Uniprot ID: P46976
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | PQVSDSMRKVLETVFDEVIMVDVLDSGDSAHLTLMKRP |
Gene Sequence | PQVSDSMRKVLETVFDEVIMVDVLDSGDSAHLTLMKRP |
Gene ID - Mouse | ENSMUSG00000019528 |
Gene ID - Rat | ENSRNOG00000011146 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti GYG1 pAb (ATL-HPA073229) | |
Datasheet | Anti GYG1 pAb (ATL-HPA073229) Datasheet (External Link) |
Vendor Page | Anti GYG1 pAb (ATL-HPA073229) at Atlas Antibodies |
Documents & Links for Anti GYG1 pAb (ATL-HPA073229) | |
Datasheet | Anti GYG1 pAb (ATL-HPA073229) Datasheet (External Link) |
Vendor Page | Anti GYG1 pAb (ATL-HPA073229) |